MRPS7 Antibody - BSA Free

Western Blot: MRPS7 Antibody [NBP1-81030] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: MRPS7 Antibody [NBP1-81030] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPS7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRWW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPS7 Protein (NBP1-81030PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPS7 Antibody - BSA Free

• bMRP27a
• bMRP-27a
• mitochondrial ribosomal protein S7
• MRP-S
• MRP-S7,30S ribosomal protein S7 homolog
• RPMS7,28S ribosomal protein S7, mitochondrial
• RP-S7
• S7mt

Background

MRPS7, or Mitochondrial Ribosomal Protein S7, consists of a 242 amino acid isoform that is 28 kDa, and is involved in the manufacture of proteins within the mitochondria. Researchers are currently conducting experiments on the relationship between MRPS7 and a variety of diseases and disorders, including pseudoxanthoma elasticum, pneumonia, mycobacterium tuberculosis, and genetic disease. MRPS7 interacts with ICT1, ASF1B, MRPS11, UBC, and MRPS14 through the process of translation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS7
• Entrez:
  • 51081(Human)
• Uniprot:
  • Q9Y2R9(Human)