MRPS7 Antibody

Images

 
Western Blot: MRPS7 Antibody [NBP1-81030] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MRPS7 Antibody [NBP1-81030] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRWW
Specificity
Specificity of human MRPS7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
MRPS7 Knockout HeLa Cell Lysate
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS7 Antibody

  • bMRP27a
  • bMRP-27a
  • mitochondrial ribosomal protein S7
  • MRP-S
  • MRP-S7,30S ribosomal protein S7 homolog
  • RPMS7,28S ribosomal protein S7, mitochondrial
  • RP-S7
  • S7mt

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP2-16686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45493
Species: Hu
Applications: WB, IHC, IF
NB100-556
Species: Hu
Applications: WB, IP
NBP1-87086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-91821
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98585
Species: Rt
Applications: WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-22289
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00053826-P01
Species: Hu
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81030
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MRPS7 Antibody (NBP1-81030) (0)

There are no publications for MRPS7 Antibody (NBP1-81030).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS7 Antibody (NBP1-81030) (0)

There are no reviews for MRPS7 Antibody (NBP1-81030). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS7 Antibody (NBP1-81030) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRPS7 Products

Bioinformatics Tool for MRPS7 Antibody (NBP1-81030)

Discover related pathways, diseases and genes to MRPS7 Antibody (NBP1-81030). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS7 Antibody (NBP1-81030)

Discover more about diseases related to MRPS7 Antibody (NBP1-81030).

Blogs on MRPS7

There are no specific blogs for MRPS7, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS7
Entrez
Uniprot
COVID-19 update