MRPS7 Antibody - BSA Free

Western Blot: MRPS7 Antibody [NBP1-81029] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: MRPS7 Antibody [NBP1-81029] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: MRPS7 Antibody [NBP1-81029] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPS7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPS7 Antibody - BSA Free (NBP1-81029) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MRPS7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 23172368). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRPS7 Protein (NBP1-81029PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23172368).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRPS7 Antibody - BSA Free

• bMRP27a
• bMRP-27a
• mitochondrial ribosomal protein S7
• MRP-S
• MRP-S7,30S ribosomal protein S7 homolog
• RPMS7,28S ribosomal protein S7, mitochondrial
• RP-S7
• S7mt

Background

MRPS7, or Mitochondrial Ribosomal Protein S7, consists of a 242 amino acid isoform that is 28 kDa, and is involved in the manufacture of proteins within the mitochondria. Researchers are currently conducting experiments on the relationship between MRPS7 and a variety of diseases and disorders, including pseudoxanthoma elasticum, pneumonia, mycobacterium tuberculosis, and genetic disease. MRPS7 interacts with ICT1, ASF1B, MRPS11, UBC, and MRPS14 through the process of translation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPS7 Antibody (NBP1-81029)(1)

Publication using NBP1-81029

• Sotgia F, Whitaker-Menezes D, Martinez-Outschoorn UE et al. Mitochondria fuel breast cancer metabolism: Fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle 2012-12-01 [PMID: 23172368] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: MRPS7
• Entrez:
  • 51081(Human)
• Uniprot:
  • Q9Y2R9(Human)