Recombinant Human MRPS30 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MRPS30 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-439 of Human MRPS30 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRPKEEKSQLLEN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MRPS30
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
74.03 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRPS30 Protein

  • 28S ribosomal protein S30, mitochondrial
  • DKFZp566B2024
  • mitochondrial ribosomal protein S30
  • MRP-S30
  • PAP
  • PDCD9
  • programmed cell death 9
  • Programmed cell death protein 9
  • S30mt

Background

MRPS30( AAH07735, 1 a.a. - 440 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00010884-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MRPS30 Recombinant Protein (H00010884-P01) (0)

There are no publications for MRPS30 Recombinant Protein (H00010884-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS30 Recombinant Protein (H00010884-P01) (0)

There are no reviews for MRPS30 Recombinant Protein (H00010884-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS30 Recombinant Protein (H00010884-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPS30 Products

Bioinformatics Tool for MRPS30 Recombinant Protein (H00010884-P01)

Discover related pathways, diseases and genes to MRPS30 Recombinant Protein (H00010884-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS30 Recombinant Protein (H00010884-P01)

Discover more about diseases related to MRPS30 Recombinant Protein (H00010884-P01).
 

Pathways for MRPS30 Recombinant Protein (H00010884-P01)

View related products by pathway.

Research Areas for MRPS30 Recombinant Protein (H00010884-P01)

Find related products by research area.

Blogs on MRPS30

There are no specific blogs for MRPS30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MRPS30 Antibody
NBP1-87343

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRPS30 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS30