MRPS2 Antibody - BSA Free

Western Blot: MRPS2 Antibody [NBP3-35427] - Western blot analysis of various lysates using MRPS2 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Mu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPS2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-296 of human MRPS2 (NP_057118.1).
  
  Sequence:
  MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:100 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MRPS2 Antibody - BSA Free

• 28S ribosomal protein S2, mitochondrial
• CGI-91
• mitochondrial 28S ribosomal protein S2
• mitochondrial ribosomal protein S2
• MRP-S2
• S2mt

Background

The Mitochondrial Ribosomal Protein S2, or MRPS2, consists of a 296 long amino acid isoform that is 33 kDa, and is involved in protein synthesis as a component of the 28S subunit on the mitochondrial ribosome. Disease research is currently being conducted on the relationship between MRPS2 and pneumonia and mycobacterium tuberculosis. MRPS2 has been linked to the process of translation, and interacts with MRPS5, ICT1, ESR2, MRPS14, and MRPS11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS2