New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

MRPS22 Antibody

Images

 
Western Blot: MRPS22 Antibody [NBP1-86787] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: MRPS22 Antibody [NBP1-86787] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MRPS22 Antibody [NBP1-86787] - Staining of human colon.
Genetic Strategies: Western Blot: MRPS22 Antibody [NBP1-86787] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: MRPS22 Antibody [NBP1-86787] - Staining of human cerebral cortex, colon, kidney and testis using Anti-MRPS22 antibody NBP1-86787 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: MRPS22 Antibody [NBP1-86787] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: MRPS22 Antibody [NBP1-86787] - Staining of human testis.
Immunohistochemistry-Paraffin: MRPS22 Antibody [NBP1-86787] - Staining of human kidney.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS22 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 23172368). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPS22 Protein (NBP1-86787PEP)
Publications
Read Publication using
NBP1-86787 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23172368).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS22 Antibody

  • C3orf5GK002
  • COXPD5
  • GIBT
  • mitochondrial ribosomal protein S22
  • MRP-S2228S ribosomal protein S22, mitochondrial
  • RPMS22
  • S22mt

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1277
Species: Bv, Ma, Hu, Mu
Applications: ChIP, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NBP1-80025
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00006193-M02
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
H00006202-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-24530
Species: Bv, Hu, Mu, Rt
Applications: Flow-IC, IHC, IHC-P, WB
NBP2-88192
Species: Hu
Applications: IHC, IHC-P, WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-85667
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-87797
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-93953
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-22289
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-81290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for MRPS22 Antibody (NBP1-86787)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MRPS22 Antibody (NBP1-86787) (0)

There are no reviews for MRPS22 Antibody (NBP1-86787). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPS22 Antibody (NBP1-86787) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS22 Products

Bioinformatics Tool for MRPS22 Antibody (NBP1-86787)

Discover related pathways, diseases and genes to MRPS22 Antibody (NBP1-86787). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS22 Antibody (NBP1-86787)

Discover more about diseases related to MRPS22 Antibody (NBP1-86787).
 

Pathways for MRPS22 Antibody (NBP1-86787)

View related products by pathway.

Blogs on MRPS22

There are no specific blogs for MRPS22, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS22