MRPS22 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MRPS22 Antibody [NBP1-86787] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Staining of human cerebral cortex, gastrointestinal, kidney and testis using Anti-MRPS22 antibody NBP1-86787 (A) shows similar protein distribution across tissues to independent antibody NBP1-86788 (B).

Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.

Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.

Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MRPS22 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPS22 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS22
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 23172368). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRPS22 Protein (NBP1-86787PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23172368).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPS22 Antibody - BSA Free

• C3orf5GK002
• COXPD5
• GIBT
• mitochondrial ribosomal protein S22
• MRP-S2228S ribosomal protein S22, mitochondrial
• RPMS22
• S22mt

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S21P family. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 9p, 10p, 10q, 16q, and 17q. Available sequence data analyses identified splice variants that differ in the 5' UTR; both transcripts encode the same protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPS22 Antibody (NBP1-86787)(1)

Publication using NBP1-86787

• Sotgia F, Whitaker-Menezes D, Martinez-Outschoorn UE et al. Mitochondria fuel breast cancer metabolism: Fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle 2012-12-01 [PMID: 23172368] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: MRPS22