MRPL15 Antibody

Images

 
Western Blot: MRPL15 Antibody [NBP1-92137] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: MRPL15 Antibody [NBP1-92137] - Staining in human heart muscle and pancreas tissues using anti-MRPL15 antibody. Corresponding MRPL15 RNA-seq data are presented ...read more
Western Blot: MRPL15 Antibody [NBP1-92137] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MRPL15 Antibody [NBP1-92137] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MRPL15 Antibody [NBP1-92137] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: MRPL15 Antibody [NBP1-92137] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MRPL15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LRGQPIPKRMLPPEELVPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDEN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPL15 Protein (NBP1-92137PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPL15 Antibody

  • L15mtHSPC145
  • mitochondrial ribosomal protein L15
  • MRP-L1539S ribosomal protein L15, mitochondrial
  • MRP-L7
  • RPML7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055746-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-15079
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93792
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86787
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-45937
Species: Hu
Applications: IHC, WB
2914-HT
Species: Hu
Applications: BA
NBP2-03292
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-89125
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-32572
Species: Hu
Applications: IHC, IHC-P, WB
H00006456-M01
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, IP, S-ELISA, WB
NBP2-33587
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF4079
Species: Hu
Applications: ICC, WB
NBP1-80025
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-92137
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MRPL15 Antibody (NBP1-92137) (0)

There are no publications for MRPL15 Antibody (NBP1-92137).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL15 Antibody (NBP1-92137) (0)

There are no reviews for MRPL15 Antibody (NBP1-92137). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPL15 Antibody (NBP1-92137) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPL15 Products

Bioinformatics Tool for MRPL15 Antibody (NBP1-92137)

Discover related pathways, diseases and genes to MRPL15 Antibody (NBP1-92137). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MRPL15 Antibody (NBP1-92137)

View related products by pathway.

Research Areas for MRPL15 Antibody (NBP1-92137)

Find related products by research area.

Blogs on MRPL15

There are no specific blogs for MRPL15, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL15