MRPS18B Antibody - BSA Free

Immunohistochemistry-Paraffin: MRPS18B Antibody [NBP2-48958] - Staining of human cerebellum shows weak cytoplasmic positivity in Purkinje cells, cells in molecular layer and granular layer).

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPS18B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPS18B Antibody - BSA Free (NBP2-48958) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS18B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPS18B Recombinant Protein Antigen (NBP2-48958PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRPS18B Antibody - BSA Free

• 28S ribosomal protein S18-2, mitochondrial
• C6orf1428S ribosomal protein S18b, mitochondrial
• HSPC183
• HumanS18a
• mitochondrial ribosomal protein S18-2
• mitochondrial ribosomal protein S18B
• MRP-S18-2
• MRPS18-2DKFZp564H0223
• MRP-S18-b
• mrps18-b
• PTD017
• S18amt
• S18mt-b

Background

Mitochondrial ribosomal protein S18B (MRPS18B), also known as 28S ribosomal protein S18b, ribosomal protein S18-2, C6orf14, PTD017, S18amt, HSPC183, and MRP-S18-2, is a member of the ribosomal protein S18P family. Members of this family assist in protein synthesis and are encoded by nuclear genes. The MRPS18B protein is one of three members of the family that has significant sequence similarity to bacterial S18 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS18B