MRPS18B Antibody

Images

 
Immunohistochemistry-Paraffin: MRPS18B Antibody [NBP2-48958] - Staining of human cerebellum shows weak cytoplasmic positivity in Purkinje cells, cells in molecular layer and granular layer).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS18B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRK
Specificity
Specificity of human MRPS18B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS18B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPS18B Recombinant Protein Antigen (NBP2-48958PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS18B Antibody

  • 28S ribosomal protein S18-2, mitochondrial
  • C6orf1428S ribosomal protein S18b, mitochondrial
  • HSPC183
  • HumanS18a
  • mitochondrial ribosomal protein S18-2
  • mitochondrial ribosomal protein S18B
  • MRP-S18-2
  • MRPS18-2DKFZp564H0223
  • MRP-S18-b
  • mrps18-b
  • PTD017
  • S18amt
  • S18mt-b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-97620
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NB100-61060
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP2-15581
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56484
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56414
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49627
Species: Hu
Applications: WB, IHC, IHC-P
NB100-395
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB600-936
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, ChHa, In, Pm, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, Single-Cell Western

Publications for MRPS18B Antibody (NBP2-48958) (0)

There are no publications for MRPS18B Antibody (NBP2-48958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS18B Antibody (NBP2-48958) (0)

There are no reviews for MRPS18B Antibody (NBP2-48958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRPS18B Antibody (NBP2-48958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRPS18B Products

Bioinformatics Tool for MRPS18B Antibody (NBP2-48958)

Discover related pathways, diseases and genes to MRPS18B Antibody (NBP2-48958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for MRPS18B Antibody (NBP2-48958)

Find related products by research area.

Blogs on MRPS18B

There are no specific blogs for MRPS18B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS18B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS18B