MRPS12 Antibody - BSA Free

Immunohistochemistry-Paraffin: MRPS12 Antibody [NBP2-13621] - Staining of human duodenum shows nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPS12 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEG
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPS12 Protein (NBP2-13621PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPS12 Antibody - BSA Free

• 28S ribosomal protein S12, mitochondrial
• mitochondrial ribosomal protein S12
• MPR-S12
• MRP-S12
• MT-RPS12
• ribosomal protein, mitochondrial, S12
• RPMS12
• RPS12
• RPSM12S12mt

Background

MRPS12, also known as Mitochondrial Ribosomal Protein S12, consists of a 138 amino acid isoform that is 15 kDa, and is involved in the synthesis of proteins within the mitochondria, though its specific purpose is unknown. MRPS12 is currently being used in research with several diseases and disorders, such as autosomal dominant nonsyndromic deafness, esophageal carcinoma, mycobacterium tuberculosis, esophagitis, pneumonia, carcinoma, malaria, and sensorineural hearing loss, to determine its relationship with each condition. MRPS12 interacts with SPINK7, C14orf1, UNC119, CRMP1, and LRIF1 during the process of translation.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS12