Recombinant Human MRP6 Protein

Images

 
SDS-Page: Recombinant Human MRP6 Protein [H00000368-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MRP6 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human ABCC6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ABCC6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRP6 Protein

  • Anthracycline resistance-associated protein
  • ARAPXE
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 6
  • EST349056
  • MLP1ABC34
  • MOATE
  • MOAT-E
  • MRP6ATP-binding cassette sub-family C member 6
  • multidrug resistance-associated protein 6
  • Multi-specific organic anion transporter E
  • pseudoxanthoma elasticum
  • PXE1
  • URG7

Background

ABCC6 - ATP-binding cassette, sub-family C (CFTR/MRP), member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NB100-94881
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P

Publications for MRP6 Partial Recombinant Protein (H00000368-Q01) (0)

There are no publications for MRP6 Partial Recombinant Protein (H00000368-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRP6 Partial Recombinant Protein (H00000368-Q01) (0)

There are no reviews for MRP6 Partial Recombinant Protein (H00000368-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRP6 Partial Recombinant Protein (H00000368-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRP6 Products

Bioinformatics Tool for MRP6 Partial Recombinant Protein (H00000368-Q01)

Discover related pathways, diseases and genes to MRP6 Partial Recombinant Protein (H00000368-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRP6 Partial Recombinant Protein (H00000368-Q01)

Discover more about diseases related to MRP6 Partial Recombinant Protein (H00000368-Q01).
 

Pathways for MRP6 Partial Recombinant Protein (H00000368-Q01)

View related products by pathway.

PTMs for MRP6 Partial Recombinant Protein (H00000368-Q01)

Learn more about PTMs related to MRP6 Partial Recombinant Protein (H00000368-Q01).
 

Research Areas for MRP6 Partial Recombinant Protein (H00000368-Q01)

Find related products by research area.

Blogs on MRP6

There are no specific blogs for MRP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MDMX Antibody
NB100-556

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRP6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC6