MRP6 Antibody

Immunocytochemistry/Immunofluorescence: MRP6 Antibody [NBP2-55262] - Staining of human cell line Hep G2 shows localization to nucleus & plasma membrane.

Product Discontinued

MRP6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GYLQMSPLFKAKMVAAIPGSLEPGNGGGRQGTGWNLVKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCC6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRP6 Antibody

• Anthracycline resistance-associated protein
• ARAPXE
• ATP-binding cassette, sub-family C (CFTR/MRP), member 6
• EST349056
• MLP1ABC34
• MOATE
• MOAT-E
• MRP6ATP-binding cassette sub-family C member 6
• multidrug resistance-associated protein 6
• Multi-specific organic anion transporter E
• pseudoxanthoma elasticum
• PXE1
• URG7

Background

MRP6 is encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCC6