MRP6 Antibody

Images

 
Western Blot: MRP6 Antibody [H00000368-B01P] - Analysis of ABCC6 expression in transfected 293T cell line by ABCC6 polyclonal antibody. Lane 1: ABCC6 transfected lysate(10.89 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MRP6 Antibody Summary

Immunogen
ABCC6 (NP_001072996.1, 1 a.a. - 99 a.a.) full-length human protein. MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMSPLFKAKMVAAIPGSLEPGNVRGRQGTGWNLVKS
Specificity
ABCC6 - ATP-binding cassette, sub-family C (CFTR/MRP), member 6,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ABCC6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRP6 Antibody

  • Anthracycline resistance-associated protein
  • ARAPXE
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 6
  • EST349056
  • MLP1ABC34
  • MOATE
  • MOAT-E
  • MRP6ATP-binding cassette sub-family C member 6
  • multidrug resistance-associated protein 6
  • Multi-specific organic anion transporter E
  • pseudoxanthoma elasticum
  • PXE1
  • URG7

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NB100-94881
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P

Publications for MRP6 Antibody (H00000368-B01P) (0)

There are no publications for MRP6 Antibody (H00000368-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRP6 Antibody (H00000368-B01P) (0)

There are no reviews for MRP6 Antibody (H00000368-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRP6 Antibody (H00000368-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRP6 Products

Bioinformatics Tool for MRP6 Antibody (H00000368-B01P)

Discover related pathways, diseases and genes to MRP6 Antibody (H00000368-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRP6 Antibody (H00000368-B01P)

Discover more about diseases related to MRP6 Antibody (H00000368-B01P).
 

Pathways for MRP6 Antibody (H00000368-B01P)

View related products by pathway.

PTMs for MRP6 Antibody (H00000368-B01P)

Learn more about PTMs related to MRP6 Antibody (H00000368-B01P).
 

Research Areas for MRP6 Antibody (H00000368-B01P)

Find related products by research area.

Blogs on MRP6

There are no specific blogs for MRP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC6
Entrez
Uniprot