MRGX3 Antibody - BSA Free

Western Blot: MRGX3 Antibody [NBP1-68959] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MRGX3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MRGPRX3 (MAS-related GPR, member X3) The peptide sequence was selected form the C terminal of MRGPRX3. Peptide sequence LDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRGPRX3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MRGX3 Antibody - BSA Free

• G protein-coupled receptor MRGX3
• G protein-coupled receptor SNSR2
• GPCR
• mas-related GPCR member X3
• MAS-related GPR, member X3
• mas-related G-protein coupled receptor member X3
• MRGPRX3
• MRGX3
• MRGX3G protein-coupled receptor SNSR1
• Sensory neuron-specific G-protein coupled receptor 1/2
• SNSR1
• SNSR2

Background

This gene encodes a member of the mas-related/sensory neuron specific subfamily of G protein coupled receptors. The encoded protein may be involved in sensory neuron regulation and in the modulation of pain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRGPRX3
• OMIM:
  • NP_473372(Human)
• Uniprot:
  • Q96LA9(Human)