MPDU1 Antibody

Images

 
Western Blot: MPDU1 Antibody [NBP1-84570] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MPDU1 Antibody [NBP1-84570] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] - Staining of human adrenal gland shows cytoplasmic positivity in glandular cells.
Western Blot: MPDU1 Antibody [NBP1-84570] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MPDU1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPDU1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MPDU1 Protein (NBP1-84570PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MPDU1 Antibody

  • CDGIF
  • FLJ14836
  • HBeAg-binding protein 2 binding protein A
  • Lec35
  • mannose-P-dolichol utilization defect 1 protein
  • mannose-P-dolichol utilization defect 1
  • My008
  • PP3958
  • PQLC5
  • SL15HBEBP2BPA
  • Suppressor of Lec15 and Lec35 glycosylation mutation homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05034
Species: Hu
Applications: WB, PEP-ELISA
H00001497-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2421
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
AF1717
Species: Hu
Applications: WB, IP
NBP2-57753
Species: Hu
Applications: WB, ICC/IF
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
AF1725
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-62494
Species: Hu
Applications: WB
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91658
Species: Hu
Applications: WB, IHC, IHC-P
MAB6668
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP1-91979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for MPDU1 Antibody (NBP1-84570) (0)

There are no publications for MPDU1 Antibody (NBP1-84570).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPDU1 Antibody (NBP1-84570) (0)

There are no reviews for MPDU1 Antibody (NBP1-84570). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MPDU1 Antibody (NBP1-84570) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPDU1 Products

Bioinformatics Tool for MPDU1 Antibody (NBP1-84570)

Discover related pathways, diseases and genes to MPDU1 Antibody (NBP1-84570). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPDU1 Antibody (NBP1-84570)

Discover more about diseases related to MPDU1 Antibody (NBP1-84570).
 

Pathways for MPDU1 Antibody (NBP1-84570)

View related products by pathway.

PTMs for MPDU1 Antibody (NBP1-84570)

Learn more about PTMs related to MPDU1 Antibody (NBP1-84570).

Blogs on MPDU1

There are no specific blogs for MPDU1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPDU1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPDU1