MPDU1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MPDU1 Antibody [NBP1-84570] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] -Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] -Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] -Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MPDU1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPDU1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MPDU1 Protein (NBP1-84570PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MPDU1 Antibody - BSA Free

• CDGIF
• FLJ14836
• HBeAg-binding protein 2 binding protein A
• Lec35
• mannose-P-dolichol utilization defect 1 protein
• mannose-P-dolichol utilization defect 1
• My008
• PP3958
• PQLC5
• SL15HBEBP2BPA
• Suppressor of Lec15 and Lec35 glycosylation mutation homolog

Background

MPDU1 encodes an endoplasmic reticulum membrane protein that is required for utilization of the mannose donor mannose-P-dolichol in the synthesis of lipid-linked oligosaccharides and glycosylphosphatidylinositols. Mutations in this gene result in congenital disorder of glycosylation type If. Alternative splicing results in multiple transcript variants. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MPDU1