MPDU1 Antibody


Western Blot: MPDU1 Antibody [NBP1-84570] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MPDU1 Antibody [NBP1-84570] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: MPDU1 Antibody [NBP1-84570] - Staining of human adrenal gland shows cytoplasmic positivity in glandular cells.
Western Blot: MPDU1 Antibody [NBP1-84570] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MPDU1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
Specificity of human, mouse, rat MPDU1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
MPDU1 Lysate (NBP2-65967)
Control Peptide
MPDU1 Protein (NBP1-84570PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MPDU1 Antibody

  • FLJ14836
  • HBeAg-binding protein 2 binding protein A
  • Lec35
  • mannose-P-dolichol utilization defect 1 protein
  • mannose-P-dolichol utilization defect 1
  • My008
  • PP3958
  • PQLC5
  • Suppressor of Lec15 and Lec35 glycosylation mutation homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for MPDU1 Antibody (NBP1-84570) (0)

There are no publications for MPDU1 Antibody (NBP1-84570).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPDU1 Antibody (NBP1-84570) (0)

There are no reviews for MPDU1 Antibody (NBP1-84570). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MPDU1 Antibody (NBP1-84570) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional MPDU1 Products

Bioinformatics Tool for MPDU1 Antibody (NBP1-84570)

Discover related pathways, diseases and genes to MPDU1 Antibody (NBP1-84570). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPDU1 Antibody (NBP1-84570)

Discover more about diseases related to MPDU1 Antibody (NBP1-84570).

Pathways for MPDU1 Antibody (NBP1-84570)

View related products by pathway.

PTMs for MPDU1 Antibody (NBP1-84570)

Learn more about PTMs related to MPDU1 Antibody (NBP1-84570).

Blogs on MPDU1

There are no specific blogs for MPDU1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MPDU1 Antibody and receive a gift card or discount.


Gene Symbol MPDU1