Home » STYK1 » STYK1 Antibodies » STYK1 Antibody

STYK1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: STYK1 Antibody [NBP2-13398] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Western Blot: STYK1 Antibody [NBP2-13398] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: STYK1 Antibody [NBP2-13398] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

STYK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQV PREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEV QDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYM
Specificity
Specificity of human STYK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STYK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STYK1 Protein (NBP2-13398PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STYK1 Antibody

  • DKFZp761P1010
  • EC 2.7.10.2
  • NOK
  • NOKProtein PK-unique
  • serine/threonine/tyrosine kinase 1Novel oncogene with kinase domain
  • STYK1
  • SuRTK106
  • tyrosine-protein kinase STYK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PALS1/MPP5 Antibody
NB300-952
Immunocytochemistry/Immunofluorescence: PALS1/MPP5 Antibody [NB300-952] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing Golgi and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunohistochemistry-Paraffin: PALS1/MPP5 Antibody [NB300-952] - Staining of paraffin embedded Human Kidney. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Flow Cytometry: PALS1/MPP5 Antibody [NB300-952] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(8 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Enolase 1 Antibody
(8G8)
H00002023-M01
Western Blot: Enolase 1 Antibody (8G8) [H00002023-M01] - Analysis of ENO1 expression in transfected 293T cell line by ENO1 monoclonal antibody (M01), clone 8G8.Lane 1: ENO1 transfected lysate(47 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: Enolase 1 Antibody (8G8) [H00002023-M01] - Analysis of monoclonal antibody to ENO1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Enolase 1 Antibody (8G8) [H00002023-M01] - Analysis of monoclonal antibody to ENO1 on formalin-fixed paraffin-embedded human lymphoma tissue. Antibody concentration 1 ug/ml.
(7 Publications)
Species: Hu, Fe
Applications: WB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, S-ELISA
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(21 Reviews)
(458 Publications)
Species: Hu
RNF130 Antibody
NBP1-81858
Western Blot: RNF130 Antibody [NBP1-81858] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-478
Immunohistochemistry-Paraffin: RNF130 Antibody [NBP1-81858] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: WB, IHC, IHC-P
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
CTGF/CCN2 Antibody
(88430) - C-terminus
MAB660
CTGF/CCN2 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using 25 µg/mL Human CTGF/CCN2 C-Terminus Monoclonal Antibody (Catalog # MAB660) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Reviews)
(6 Publications)
Species: Hu
Applications: IHC
Cytokeratin 5
Antibody (EP1601Y)
NB110-56916
Western Blot: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - Expression of cytokeratins (CK) and GAPDH in HMGEC. Representative western blots show specific bands for GAPDH, CK1, Cytokeratin 5, CK6 and CK14. Image collected and cropped by CiteAb from the following publication (https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0128096) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - A431 cells.
Immunohistochemistry-Paraffin: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - Cytokeratin 5 (EP1601Y) on prostate.
(8 Publications)
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Tenascin C
Antibody (4C8MS)
NB110-68136
Flow (Intracellular): Tenascin C Antibody (4C8MS) [NB110-68136] - Figure A: Intracellular stain performed on U87MG Cells with Tenascin C (4C8MS) antibody NB110-68136 (blue) and a matched isotype control NBP1-97005 (orange). Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody [F0101B, R&D Systems].Figure B: U87MG Cells were either untreated (orange) or treated with 3uM Monensin (blue). An intracellular stain was performed with Tenascin C (4C8MS) antibody NB110-68136. Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody [F0101B, R&D Systems].
Western Blot: Tenascin C Antibody (4C8MS) [NB110-68136] - Regulation of Tenascin C expression and its effect on fibrotic responses. Confluent foreskin fibroblasts were incubated with TGF-beta (10 ng ml-1 or indicated concentrations) or Tenascin C (TNC) for 24 or 72 h or indicated periods. Whole-cell lysates, culture media and RNA were examined by western analysis (upper panels) and qPCR (lower panel). Representative immunoblots or qPCR results (means+/-s.e.m. of triplicate determinations). S, secreted; L, lysates. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms11703), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Tenascin C Antibody (4C8MS) [NB110-68136] - SK-MEL-28 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Tenascin C at 5 ug/ml overnight at 4C and detected with an anti-Mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(20 Publications)
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
LIN7 Antibody
NBP2-15016
Western Blot: LIN7 Antibody [NBP2-15016] - Sample (30 ug of whole cell lysate) A: MCF-7 12% SDS PAGE; antibody diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: LIN7 Antibody [NBP2-15016] - Analysis of methanol-fixed MCF-7, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: LIN7 Antibody [NBP2-15016] - Paraffin-embedded Colon ca, using antibody at 1:250 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Tight Junction
Protein 1 Antibody
NBP1-85047
Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Rat epithelial cells stained positively with Tight Junction Protein 1. Primary antibody at 1:100. Secondary antibody: goat anti-rabbit-Alexa 488 conjugated at 1:500. ICC/IF image submitted by a verified customer review.
(5 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
FGFR3 Antibody
(JM110-33)
NBP2-66840
Western Blot: FGFR3 Antibody (JM110-33) [NBP2-66840] - Analysis of FGFR3 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.Positive control: Lane 1: Hela cell lysateLane 2: HepG2 cell lysateLane 3: 293 cell lysateLane 4: MCF-7 cell lysate
Immunocytochemistry/Immunofluorescence: FGF R3 Antibody (JM110-33) [NBP2-66840] - Staining FGFR3 in SH-SY5Y cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: FGF R3 Antibody (JM110-33) [NBP2-66840] - Analysis of paraffin-embedded mouse testis tissue using anti-FGFR3 antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
STYK1 Antibody
NBP2-13398
STYK1 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for STYK1 Antibody (NBP2-13398) (0)

There are no publications for STYK1 Antibody (NBP2-13398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STYK1 Antibody (NBP2-13398) (0)

There are no reviews for STYK1 Antibody (NBP2-13398). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STYK1 Antibody (NBP2-13398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional STYK1 Products

Bioinformatics Tool for STYK1 Antibody (NBP2-13398)

Discover related pathways, diseases and genes to STYK1 Antibody (NBP2-13398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STYK1 Antibody (NBP2-13398)

Discover more about diseases related to STYK1 Antibody (NBP2-13398).
 

Pathways for STYK1 Antibody (NBP2-13398)

View related products by pathway.

PTMs for STYK1 Antibody (NBP2-13398)

Learn more about PTMs related to STYK1 Antibody (NBP2-13398).
 

Research Areas for STYK1 Antibody (NBP2-13398)

Find related products by research area.

Blogs on STYK1

There are no specific blogs for STYK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STYK1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol STYK1