Home » STYK1 » STYK1 Antibodies » STYK1 Antibody

STYK1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: STYK1 Antibody [NBP2-13398] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Western Blot: STYK1 Antibody [NBP2-13398] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: STYK1 Antibody [NBP2-13398] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

STYK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQV PREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEV QDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYM
Specificity
Specificity of human STYK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STYK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STYK1 Protein (NBP2-13398PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STYK1 Antibody

  • DKFZp761P1010
  • EC 2.7.10.2
  • NOK
  • NOKProtein PK-unique
  • serine/threonine/tyrosine kinase 1Novel oncogene with kinase domain
  • STYK1
  • SuRTK106
  • tyrosine-protein kinase STYK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PALS1/MPP5 Antibody
AF7979
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, bEnd.3 mouse endothelioma cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human/Mouse/Rat PALS1/MPP5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7979) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PALS1/MPP5 at approximately 75-80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
EGFR Antibody
[Unconjugated]
AF231
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
A431 human epithelial carcinoma cell line was stained with Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(7 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Enolase 1 Antibody
(253)
NBP2-25147
Western Blot: Enolase 1 Antibody (253) [NBP2-25147] - Analysis of different cell lysates using mouse mAb to alpha-enolase, NBP2-25147, dilution 1:10,000 in green: [1] protein standard (red), [2] NIH-3T3 l, [3] C6, [4] HEK293, [5] HeLa, and [6] SH-SY5Y cells. A strong single band at 47kDa corresponds to the alpha-enolase protein.
Immunocytochemistry/Immunofluorescence: Enolase 1 Antibody (253) [NBP2-25147] - Analysis of HeLa cells stained with mouse mAb to alpha-enolase, NBP2-25147, dilution 1:500 in green and costained with chicken pAb to HSP60, dilution 1:5,000, in red. The blue is DAPI staining of nuclear DNA. NBP2-25147 antibody reveals strong cytoplasmic staining.
Immunocytochemistry/Immunofluorescence: Enolase 1 Antibody (253) [NBP2-25147] - Rat 3T3 cells stained with NBP2-25147 (green) and counterstained with chicken polyclonal antibody to Vimentin NB300-223 (red) and DNA (blue). NBP2-25147 reveals strong cytoplasmic staining, while the Vimentin antibody reveals cytoplasmic intermediate filaments.
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC
EGF [Unconjugated]
236-EG
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
(10 Reviews)
(299 Publications)
Species: Hu
RNF130 Antibody
NBP1-81858
Western Blot: RNF130 Antibody [NBP1-81858] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-478
Immunohistochemistry-Paraffin: RNF130 Antibody [NBP1-81858] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: WB, IHC, IHC-P
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(492 Publications)
Species: Hu
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
CTGF/CCN2 Antibody
NB100-724
Immunocytochemistry/Immunofluorescence: CTGF/CCN2 Antibody [NB100-724] - CTGF antibody was tested in U2OS cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Cytokeratin 5
Antibody (EP1601Y)
NB110-56916
Immunocytochemistry/Immunofluorescence: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - A431 cells.
Immunohistochemistry-Paraffin: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - Cytokeratin 5 (EP1601Y) on prostate.
Immunohistochemistry-Paraffin: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - Cytokeratin 5 antibody labels squamous elements in the basal epidermis and sebaceous glands.
(6 Publications)
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Tenascin C
Antibody (4C8MS)
NB110-68136
Flow (Intracellular): Tenascin C Antibody (4C8MS) [NB110-68136] - Figure A: An intracellular stain was performed on U87MG Cells with Tenascin C (4C8MS) antibody NB110-68136 (blue) and a matched isotype control NBP1-97005 (orange). Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody [F0101B, R&D Systems].Figure B: U87MG Cells were either untreated (orange) or treated with 3uM Monensin (blue). An intracellular stain was performed with Tenascin C (4C8MS) antibody NB110-68136. Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody [F0101B, R&D Systems].
Immunohistochemistry-Paraffin: Tenascin C Antibody (4C8MS) [NB110-68136] - IHC analysis of a formalin fixed paraffin embedded tissue section of mouse bone-tendon using Tenascin C antibody (clone 4C8MS) at 1:25 dilution. The signal was detected using HRP-DAB detection method which followed counterstaining using hematoxylin. The antibody generated a very specific cytoplasmic, membrane and extra-cellular signal in tendon fibroblasts, osteoblasts, osteoclasts, and some bone marrow cells. The mineralized areas were largely negative for the staining.
Flow Cytometry: Tenascin C Antibody (4C8MS) [NB110-68136] - An intracellular stain was performed on SK-MEL-28 cells with Tenascin C Antibody (4C8MS) NB110-68136 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
LIN7 Antibody
NBP2-15016
Western Blot: LIN7 Antibody [NBP2-15016] - Sample (30 ug of whole cell lysate) A: MCF-7 12% SDS PAGE; antibody diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: LIN7 Antibody [NBP2-15016] - Analysis of methanol-fixed MCF-7, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: LIN7 Antibody [NBP2-15016] - Paraffin-embedded Colon ca, using antibody at 1:250 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. Image from verified customer review.
(4 Reviews)
(1 Publication)
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining in human lymph node and liver tissues using anti-POLD1 antibody. Corresponding POLD1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
FGF R3 Antibody
(136312) [Unconjugate ...
MAB7662
FGF R3 was detected in immersion fixed U937 human histiocytic lymphoma cell line using Mouse Anti-Human FGF R3 (IIIc) Monoclonal Antibody (Catalog # MAB7662) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
FGF R3 was detected in immersion fixed paraffin-embedded sections of human bladder cancer tissue using Mouse Anti-Human FGF R3 (IIIc) Monoclonal Antibody (Catalog # MAB7662) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to smooth muscle cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, IHC, ICC
STYK1 Antibody
NBP2-13398
STYK1 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for STYK1 Antibody (NBP2-13398) (0)

There are no publications for STYK1 Antibody (NBP2-13398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STYK1 Antibody (NBP2-13398) (0)

There are no reviews for STYK1 Antibody (NBP2-13398). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STYK1 Antibody (NBP2-13398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STYK1 Products

Bioinformatics Tool for STYK1 Antibody (NBP2-13398)

Discover related pathways, diseases and genes to STYK1 Antibody (NBP2-13398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STYK1 Antibody (NBP2-13398)

Discover more about diseases related to STYK1 Antibody (NBP2-13398).
 

Pathways for STYK1 Antibody (NBP2-13398)

View related products by pathway.

PTMs for STYK1 Antibody (NBP2-13398)

Learn more about PTMs related to STYK1 Antibody (NBP2-13398).
 

Research Areas for STYK1 Antibody (NBP2-13398)

Find related products by research area.

Blogs on STYK1

There are no specific blogs for STYK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STYK1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol STYK1
Entrez