STYK1 Antibody

Images

 
Western Blot: STYK1 Antibody [NBP2-13398] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: STYK1 Antibody [NBP2-13398] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STYK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQV PREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEV QDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STYK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STYK1 Protein (NBP2-13398PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STYK1 Antibody

  • DKFZp761P1010
  • EC 2.7.10.2
  • NOK
  • NOKProtein PK-unique
  • serine/threonine/tyrosine kinase 1Novel oncogene with kinase domain
  • STYK1
  • SuRTK106
  • tyrosine-protein kinase STYK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7979
Species: Hu, Mu, Rt
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB110-56916
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-15016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-13398
Species: Hu
Applications: WB, IHC, IHC-P

Publications for STYK1 Antibody (NBP2-13398) (0)

There are no publications for STYK1 Antibody (NBP2-13398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STYK1 Antibody (NBP2-13398) (0)

There are no reviews for STYK1 Antibody (NBP2-13398). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STYK1 Antibody (NBP2-13398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STYK1 Products

Bioinformatics Tool for STYK1 Antibody (NBP2-13398)

Discover related pathways, diseases and genes to STYK1 Antibody (NBP2-13398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STYK1 Antibody (NBP2-13398)

Discover more about diseases related to STYK1 Antibody (NBP2-13398).
 

Pathways for STYK1 Antibody (NBP2-13398)

View related products by pathway.

PTMs for STYK1 Antibody (NBP2-13398)

Learn more about PTMs related to STYK1 Antibody (NBP2-13398).
 

Research Areas for STYK1 Antibody (NBP2-13398)

Find related products by research area.

Blogs on STYK1

There are no specific blogs for STYK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STYK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STYK1
Entrez