HDC2/PHC2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HDC2/PHC2 Antibody [NBP1-91979] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green

Immunohistochemistry-Paraffin: HDC2/PHC2 Antibody [NBP1-91979] - Staining of human prostate shows distinct nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HDC2/PHC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HDC2/PHC2 Antibody - BSA Free (NBP1-91979) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PQLASVSPSVALQPSSEAHAMPLGPVTPALPLQCPTANLHKPGGSQQCHPPTPDTGPQNGHPEGVPHTPQRRFQHTSAVILQLQPASPVPQQCVPDDWKEVAPGEKSVPETRSGPSPHQQAIVTAMP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HDC2/PHC2 Protein (NBP1-91979PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HDC2/PHC2 Antibody - BSA Free

• early development regulator 2 (homolog of polyhomeotic 2)
• Early development regulatory protein 2
• EDR2
• HPH2
• MGC163502
• PH2
• polyhomeotic 2
• polyhomeotic homolog 2 (Drosophila)
• polyhomeotic-like 2 (Drosophila)
• polyhomeotic-like 2
• polyhomeotic-like protein 2

Background

In Drosophila melanogaster, the 'Polycomb' group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein 'polyhomeotic' (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHC2