MOXD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MOXD1 Antibody [NBP1-84233] - Staining of human cell line BJ shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human kidney shows strong cytoplasmic positivity, seen with a granular pattern in cells in tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOXD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DINDKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFDLVNQDVPIPNKDTTYWCQMFKIPVFQEKHHVIKVEPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOXD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MOXD1 Protein (NBP1-84233PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOXD1 Antibody

  • dJ248E1.1
  • DKFZP564G202
  • dopamine-oxygenase
  • EC 1.14.17
  • EC 1.14.17.-
  • Monooxygenase X
  • monooxygenase, DBH-like 1
  • MOXDBH-like monooxygenase protein 1
  • PRO5780

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP2-46085
Species: Hu
Applications: WB, IHC

Publications for MOXD1 Antibody (NBP1-84233) (0)

There are no publications for MOXD1 Antibody (NBP1-84233).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOXD1 Antibody (NBP1-84233) (0)

There are no reviews for MOXD1 Antibody (NBP1-84233). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MOXD1 Antibody (NBP1-84233) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOXD1 Products

Bioinformatics Tool for MOXD1 Antibody (NBP1-84233)

Discover related pathways, diseases and genes to MOXD1 Antibody (NBP1-84233). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOXD1 Antibody (NBP1-84233)

Discover more about diseases related to MOXD1 Antibody (NBP1-84233).
 

Pathways for MOXD1 Antibody (NBP1-84233)

View related products by pathway.

PTMs for MOXD1 Antibody (NBP1-84233)

Learn more about PTMs related to MOXD1 Antibody (NBP1-84233).

Blogs on MOXD1

There are no specific blogs for MOXD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOXD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOXD1