MOX1 Antibody (4B11)

Images

 
Immunocytochemistry/ Immunofluorescence: MOX1 Antibody (4B11) [H00004222-M07] - Analysis of monoclonal antibody to MEOX1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: MOX1 Antibody (4B11) [H00004222-M07] - Detection limit for recombinant GST tagged MEOX1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
4B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MOX1 Antibody (4B11) Summary

Immunogen
MEOX1 (NP_004518.1, 165 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
Specificity
MEOX1 - mesenchyme homeobox 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MEOX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MOX1 Antibody (4B11)

  • homeobox protein MOX-1
  • mesenchyme homeobox 1MOX1mesenchyme homeo box 1

Background

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2457
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
H00004223-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF4937
Species: Hu
Applications: IHC, WB
H00001032-M08
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
1887-ML/CF
Species: Mu
Applications: BA
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
AF3635
Species: Mu
Applications: IHC, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NBP3-12330
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NB100-1268
Species: Hu, Mu, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, PEP-ELISA, WB
NBP1-41012
Species: Hu
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-84264
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, KD, WB
AF2724
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB

Publications for MOX1 Antibody (H00004222-M07) (0)

There are no publications for MOX1 Antibody (H00004222-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOX1 Antibody (H00004222-M07) (0)

There are no reviews for MOX1 Antibody (H00004222-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MOX1 Antibody (H00004222-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOX1 Antibody (4B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol MEOX1
Entrez
OMIM
Uniprot