MOSPD1 Antibody

Images

 
Western Blot: MOSPD1 Antibody [NBP1-84220] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: MOSPD1 Antibody [NBP1-84220] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: MOSPD1 Antibody [NBP1-84220] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Western Blot: MOSPD1 Antibody [NBP1-84220] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-350

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOSPD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOSPD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MOSPD1 Protein (NBP1-84220PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOSPD1 Antibody

  • dJ473B4
  • motile sperm domain containing 1
  • motile sperm domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85698
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-93499
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF5629
Species: Hu, Mu
Applications: WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP2-46205
Species: Hu
Applications: WB, IHC

Publications for MOSPD1 Antibody (NBP1-84220) (0)

There are no publications for MOSPD1 Antibody (NBP1-84220).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOSPD1 Antibody (NBP1-84220) (0)

There are no reviews for MOSPD1 Antibody (NBP1-84220). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MOSPD1 Antibody (NBP1-84220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOSPD1 Products

Bioinformatics Tool for MOSPD1 Antibody (NBP1-84220)

Discover related pathways, diseases and genes to MOSPD1 Antibody (NBP1-84220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOSPD1 Antibody (NBP1-84220)

Discover more about diseases related to MOSPD1 Antibody (NBP1-84220).
 

Pathways for MOSPD1 Antibody (NBP1-84220)

View related products by pathway.

Blogs on MOSPD1

There are no specific blogs for MOSPD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOSPD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOSPD1