MORC3 Antibody

Images

 
Western Blot: MORC3 Antibody [NBP1-83036] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MORC3 Antibody [NBP1-83036] - Staining of human esophagus shows nuclear and cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MORC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QETTDKSADDAGCQLQELRNQLLLVTEEKENYKRQCHMFTDQIKVLQQRILEMNDKYVKKETCHQSTETDAVFLLESINGKSESPDHMVSQYQQALEEI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MORC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MORC3 Protein (NBP1-83036PEP)
Publications
Read Publications using
NBP1-83036 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MORC3 Antibody

  • KIAA0136
  • MORC family CW-type zinc finger 3
  • MORC family CW-type zinc finger protein 3
  • nuclear matrix protein NXP2
  • NXP2
  • ZCW5
  • ZCWCC3
  • Zinc finger CW-type coiled-coil domain protein 3
  • zinc finger, CW type with coiled-coil domain 3
  • zinc finger, CW-type with coiled-coil domain 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
MAB6967
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-56483
Species: Hu
Applications: ICC/IF
NBP2-04611
Species: Hu
NB200-352
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-00997
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-04663
Species: Hu
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14842
Species: Hu, Po, Bv, Ca, Pm, Rb
Applications: WB
NBP1-83036
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MORC3 Antibody (NBP1-83036)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for MORC3 Antibody (NBP1-83036) (0)

There are no reviews for MORC3 Antibody (NBP1-83036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MORC3 Antibody (NBP1-83036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MORC3 Products

Bioinformatics Tool for MORC3 Antibody (NBP1-83036)

Discover related pathways, diseases and genes to MORC3 Antibody (NBP1-83036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MORC3 Antibody (NBP1-83036)

Discover more about diseases related to MORC3 Antibody (NBP1-83036).
 

Pathways for MORC3 Antibody (NBP1-83036)

View related products by pathway.

PTMs for MORC3 Antibody (NBP1-83036)

Learn more about PTMs related to MORC3 Antibody (NBP1-83036).

Blogs on MORC3

There are no specific blogs for MORC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MORC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MORC3