![Western Blot: MORC3 Antibody [NBP1-83036] - Total and purified protein fractions from mock (m) & wt HSV-1 (wt; MOI 10 12 h p.i.) infected HA-HisSUMO2 cells analyzed by WB (uninfected HA-His only total protein & purified fractions as controls; mock infected = m; infected samples = wt). Probable sumoylated species of PML, NACC1, ZBTB10, ZBTB38, ZBTB4 and MORC3 detected in uninfected purified samples (indicated by dashes on the right of panels), & reduced in abundance during HSV-1 infection. ZBTB7A showed increased SUMO2-modification in infected purified fractions. RanGAP1 used as an unchanged control for SUMO2-modification following HSV-1 infection. The predicted unmodified molecular weight of each protein is indicated in each panel; major unmodified form is marked by an asterisk - this refers to the major isoforms PML.I and PML.II. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.ppat.1005059), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/MORC3-Antibody-Western-Blot-NBP1-83036-img0008.jpg "Western Blot: MORC3 Antibody [NBP1-83036] - Total and purified protein fractions from mock (m) & wt HSV-1 (wt; MOI 10 12 h p.i.) infected HA-HisSUMO2 cells analyzed by WB (uninfected HA-His only total protein & purified fractions as controls; mock infected = m; infected samples = wt). Probable sumoylated species of PML, NACC1, ZBTB10, ZBTB38, ZBTB4 and MORC3 detected in uninfected purified samples (indicated by dashes on the right of panels), & reduced in abundance during HSV-1 infection. ZBTB7A showed increased SUMO2-modification in infected purified fractions. RanGAP1 used as an unchanged control for SUMO2-modification following HSV-1 infection. The predicted unmodified molecular weight of each protein is indicated in each panel; major unmodified form is marked by an asterisk - this refers to the major isoforms PML.I and PML.II. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.ppat.1005059), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit MORC3 Antibody - BSA Free (NBP1-83036) is a polyclonal antibody validated for use in IHC and WB. Anti-MORC3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QETTDKSADDAGCQLQELRNQLLLVTEEKENYKRQCHMFTDQIKVLQQRILEMNDKYVKKETCHQSTETDAVFLLESINGKSESPDHMVSQYQQALEEI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MORC3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MORC3 Antibody (NBP1-83036)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MORC3 |
![Immunohistochemistry-Paraffin: MORC3 Antibody [NBP1-83036] - Staining of human esophagus shows nuclear and cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/MORC3-Antibody-Immunohistochemistry-Paraffin-NBP1-83036-img0006.jpg "Immunohistochemistry-Paraffin: MORC3 Antibody [NBP1-83036] - Staining of human esophagus shows nuclear and cytoplasmic positivity in squamous epithelial cells.")
![Western Blot: MORC3 Antibody [NBP1-83036] - Analysis in human cell line SiHa.](http://images.novusbio.com/fullsize/MORC3-Antibody-Western-Blot-NBP1-83036-img0007.jpg "Western Blot: MORC3 Antibody [NBP1-83036] - Analysis in human cell line SiHa.")
![Western Blot: MORC3 Antibody [NBP1-83036] - Influence of a SUMO interaction motif within ICP0 on the stability of selected proteins during HSV-1 infection. HepaRG cells were infected with wt or mSLS4 mutant HSV-1 and samples taken at 3, 6 and 10 h after infection were analyzed for the abundance of NACC1, MORC3 and ZBTB38 as indicated. The MOI were adjusted to ensure similar levels of viral gene expression (10 for wt, 20 for mSLS4), as shown in the ICP0, ICP4 and UL42 panels. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.ppat.1005059), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/MORC3-Antibody-Western-Blot-NBP1-83036-img0009.jpg "Western Blot: MORC3 Antibody [NBP1-83036] - Influence of a SUMO interaction motif within ICP0 on the stability of selected proteins during HSV-1 infection. HepaRG cells were infected with wt or mSLS4 mutant HSV-1 and samples taken at 3, 6 and 10 h after infection were analyzed for the abundance of NACC1, MORC3 and ZBTB38 as indicated. The MOI were adjusted to ensure similar levels of viral gene expression (10 for wt, 20 for mSLS4), as shown in the ICP0, ICP4 and UL42 panels. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.ppat.1005059), licensed under a CC-BY license.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")