MORC3 Antibody


Western Blot: MORC3 Antibody [NBP1-53029] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MORC3 Antibody Summary

Synthetic peptides corresponding to MORC3(MORC family CW-type zinc finger 3) The peptide sequence was selected from the N terminal of MORC3. Peptide sequence KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MORC3 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MORC3 Antibody

  • KIAA0136
  • MORC family CW-type zinc finger 3
  • MORC family CW-type zinc finger protein 3
  • nuclear matrix protein NXP2
  • NXP2
  • ZCW5
  • ZCWCC3
  • Zinc finger CW-type coiled-coil domain protein 3
  • zinc finger, CW type with coiled-coil domain 3
  • zinc finger, CW-type with coiled-coil domain 3


MORC3 localizes to the nuclear matrix. Also, MORC3 has RNA binding activity, and has a predicted coiled-coil domain. This gene encodes a protein that localizes to the nuclear matrix. The protein also has RNA binding activity, and has a predicted coiled-coil domain.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, Micro
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Po, Bv, Ca, Pm, Rb
Applications: WB
Species: Hu
Applications: WB

Publications for MORC3 Antibody (NBP1-53029) (0)

There are no publications for MORC3 Antibody (NBP1-53029).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MORC3 Antibody (NBP1-53029) (0)

There are no reviews for MORC3 Antibody (NBP1-53029). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MORC3 Antibody (NBP1-53029) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MORC3 Products

Bioinformatics Tool for MORC3 Antibody (NBP1-53029)

Discover related pathways, diseases and genes to MORC3 Antibody (NBP1-53029). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MORC3 Antibody (NBP1-53029)

Discover more about diseases related to MORC3 Antibody (NBP1-53029).

Pathways for MORC3 Antibody (NBP1-53029)

View related products by pathway.

PTMs for MORC3 Antibody (NBP1-53029)

Learn more about PTMs related to MORC3 Antibody (NBP1-53029).

Blogs on MORC3

There are no specific blogs for MORC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MORC3 Antibody and receive a gift card or discount.


Gene Symbol MORC3