MOGAT1 Antibody

Images

 
Immunohistochemistry-Paraffin: MOGAT1 Antibody [NBP2-14245] Staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOGAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOGAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MOGAT1 Protein (NBP2-14245PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOGAT1 Antibody

  • Acyl-CoA:monoacylglycerol acyltransferase 1
  • DC2
  • DGAT2L
  • Diacylglycerol acyltransferase 2-like protein 1
  • diacylglycerol O-acyltransferase 2 like 1,2-acylglycerol O-acyltransferase 1
  • Diacylglycerol O-acyltransferase candidate 2
  • EC 2.3.1
  • EC 2.3.1.22
  • MGAT1hDC2
  • monoacylglycerol O-acyltransferase 1DGAT2L1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85230
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14235
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83858
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14245
Species: Hu
Applications: IHC, IHC-P

Publications for MOGAT1 Antibody (NBP2-14245) (0)

There are no publications for MOGAT1 Antibody (NBP2-14245).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOGAT1 Antibody (NBP2-14245) (0)

There are no reviews for MOGAT1 Antibody (NBP2-14245). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MOGAT1 Antibody (NBP2-14245) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOGAT1 Products

Bioinformatics Tool for MOGAT1 Antibody (NBP2-14245)

Discover related pathways, diseases and genes to MOGAT1 Antibody (NBP2-14245). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOGAT1 Antibody (NBP2-14245)

Discover more about diseases related to MOGAT1 Antibody (NBP2-14245).
 

Pathways for MOGAT1 Antibody (NBP2-14245)

View related products by pathway.

Blogs on MOGAT1

There are no specific blogs for MOGAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOGAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOGAT1