MOGAT2 Antibody

Images

 
Western Blot: MOGAT2 Antibody [NBP1-85230] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: MOGAT2 Antibody [NBP1-85230] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOGAT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPIFSFGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOGAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MOGAT2 Protein (NBP1-85230PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOGAT2 Antibody

  • acyl CoA:monoacylglycerol acyltransferase 2
  • Acyl-CoA:monoacylglycerol acyltransferase 2
  • DC5
  • DGAT2L5MGC119183
  • Diacylglycerol acyltransferase 2-like protein 5
  • Diacylglycerol O-acyltransferase candidate 5
  • EC 2.3.1
  • EC 2.3.1.22
  • FLJ22644
  • hDC5
  • hMGAT2
  • MGAT2MGC119184
  • MGC119185
  • monoacylglycerol O-acyltransferase 22-acylglycerol O-acyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81827
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14245
Species: Hu
Applications: IHC, IHC-P
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-84299
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71701
Species: Hu, Mu
Applications: WB
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-88641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF3369
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF2569
Species: Hu
Applications: WB, ICC
NBP2-33664
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8864
Species: Hu
Applications: IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85230
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MOGAT2 Antibody (NBP1-85230) (0)

There are no publications for MOGAT2 Antibody (NBP1-85230).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOGAT2 Antibody (NBP1-85230) (0)

There are no reviews for MOGAT2 Antibody (NBP1-85230). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOGAT2 Antibody (NBP1-85230) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOGAT2 Products

Bioinformatics Tool for MOGAT2 Antibody (NBP1-85230)

Discover related pathways, diseases and genes to MOGAT2 Antibody (NBP1-85230). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOGAT2 Antibody (NBP1-85230)

Discover more about diseases related to MOGAT2 Antibody (NBP1-85230).
 

Pathways for MOGAT2 Antibody (NBP1-85230)

View related products by pathway.

PTMs for MOGAT2 Antibody (NBP1-85230)

Learn more about PTMs related to MOGAT2 Antibody (NBP1-85230).

Blogs on MOGAT2

There are no specific blogs for MOGAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOGAT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOGAT2