MOG Antibody

Images

 
Western Blot: Myelin oligodendrocyte glycoprotein Antibody [NBP1-87458] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Myelin oligodendrocyte glycoprotein Antibody [NBP1-87458] - Staining of human cell line U-2 OS shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: Myelin oligodendrocyte glycoprotein Antibody [NBP1-87458] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in subsets of glial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Marker
Oligodendrocyte Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MOG Protein (NBP1-87458PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOG Antibody

  • MGC26137
  • MOG Ig-AluB
  • MOG
  • MOGIG2
  • myelin oligodendrocyte glycoprotein
  • myelin-oligodendrocyte glycoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
AF1674
Species: Mu
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-87458
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MOG Antibody (NBP1-87458) (0)

There are no publications for MOG Antibody (NBP1-87458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOG Antibody (NBP1-87458) (0)

There are no reviews for MOG Antibody (NBP1-87458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MOG Antibody (NBP1-87458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOG Products

Bioinformatics Tool for MOG Antibody (NBP1-87458)

Discover related pathways, diseases and genes to MOG Antibody (NBP1-87458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOG Antibody (NBP1-87458)

Discover more about diseases related to MOG Antibody (NBP1-87458).
 

Pathways for MOG Antibody (NBP1-87458)

View related products by pathway.

PTMs for MOG Antibody (NBP1-87458)

Learn more about PTMs related to MOG Antibody (NBP1-87458).
 

Research Areas for MOG Antibody (NBP1-87458)

Find related products by research area.

Blogs on MOG

There are no specific blogs for MOG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOG
Entrez