MOCS3 Antibody

Images

 
Immunohistochemistry-Paraffin: MOCS3 Antibody [NBP2-14244] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOCS3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FQDEILRSSRQLVLPELGVHRHVLVVGCGGLRCPLAQYLAAASVGRLGLV DYDVVEMSNLAYQVLHGEALAAQAKAASAAASLRGLNLAVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOCS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MOCS3 Protein (NBP2-14244PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOCS3 Antibody

  • adenylyltransferase and sulfurtransferase MOCS3
  • dJ914P20.3
  • molybdenum cofactor synthesis 3
  • Molybdenum cofactor synthesis protein 3
  • Molybdopterin synthase sulfurylase
  • MPT synthase sulfurylase
  • UBA4, ubiquitin-activating enzyme E1 homolog
  • UBA4MGC9252
  • ubiquitin-like modifier activating enzyme 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

UL-950
Species: Hu
NBP1-81045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03449
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92130
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46161
Species: Hu
Applications: WB, IHC
NBP1-32423
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88457
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5928
Species: Hu
Applications: WB, IHC, ICC
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-84276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP1-87770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057167-M03
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP1-89266
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MOCS3 Antibody (NBP2-14244) (0)

There are no publications for MOCS3 Antibody (NBP2-14244).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOCS3 Antibody (NBP2-14244) (0)

There are no reviews for MOCS3 Antibody (NBP2-14244). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MOCS3 Antibody (NBP2-14244) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOCS3 Products

Bioinformatics Tool for MOCS3 Antibody (NBP2-14244)

Discover related pathways, diseases and genes to MOCS3 Antibody (NBP2-14244). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOCS3 Antibody (NBP2-14244)

Discover more about diseases related to MOCS3 Antibody (NBP2-14244).
 

Pathways for MOCS3 Antibody (NBP2-14244)

View related products by pathway.

PTMs for MOCS3 Antibody (NBP2-14244)

Learn more about PTMs related to MOCS3 Antibody (NBP2-14244).

Blogs on MOCS3

There are no specific blogs for MOCS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOCS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOCS3