CTU2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CTU2 Antibody [NBP1-88457] - Staining of human cell line U-2 OS shows positivity in cytoplasm and mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CTU2 Antibody [NBP1-88457] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTU2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSPDSFCLGFSEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTU2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CTU2 Protein (NBP1-88457PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CTU2 Antibody

  • C16orf84
  • chromosome 16 open reading frame 84
  • cytoplasmic tRNA 2-thiolation protein 2
  • cytosolic thiouridylase subunit 2 homolog (S. pombe)
  • MGC131681
  • MGC148063
  • NCS2MGC148064
  • UPF0432

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

UL-950
Species: Hu
NBP2-17320
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89820
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-669
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
AF5480
Species: Hu
Applications: IHC
NBP1-91733
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF5866
Species: Hu
Applications: WB, IHC
NBP2-47500
Species: Hu
Applications: IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7895
Species: Hu
Applications: WB, IHC
NBP1-88457
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CTU2 Antibody (NBP1-88457) (0)

There are no publications for CTU2 Antibody (NBP1-88457).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTU2 Antibody (NBP1-88457) (0)

There are no reviews for CTU2 Antibody (NBP1-88457). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CTU2 Antibody (NBP1-88457) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTU2 Products

Bioinformatics Tool for CTU2 Antibody (NBP1-88457)

Discover related pathways, diseases and genes to CTU2 Antibody (NBP1-88457). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CTU2 Antibody (NBP1-88457)

View related products by pathway.

PTMs for CTU2 Antibody (NBP1-88457)

Learn more about PTMs related to CTU2 Antibody (NBP1-88457).

Blogs on CTU2

There are no specific blogs for CTU2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTU2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTU2