MOCS2 Antibody - BSA Free

Western Blot: MOCS2 Antibody [NBP1-81045] - Analysis in control (vector only transfected HEK293T lysate) and MOCS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: MOCS2 Antibody [NBP1-81045] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Immunohistochemistry-Paraffin: MOCS2 Antibody [NBP1-81045] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MOCS2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MOCS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MOCS2 Protein (NBP1-81045PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MOCS2 Antibody - BSA Free

• EC 2.-
• MCBPE
• MOCO1-A
• MOCO1-B
• MOCO1MOCS2B
• MOCS2A
• molybdenum cofactor biosynthesis protein E
• molybdenum cofactor synthesis 2
• Molybdenum cofactor synthesis protein 2 large subunit
• Molybdenum cofactor synthesis protein 2 small subunit
• Molybdenum cofactor synthesis protein 2A
• Molybdenum cofactor synthesis protein 2B
• molybdopterin synthase catalytic subunit
• molybdopterin synthase sulfur carrier subunit
• Molybdopterin-synthase large subunit
• Molybdopterin-synthase small subunit
• MPT synthase large subunit
• MPTS
• Sulfur carrier protein MOCS2A

Background

Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MOCS2
• Entrez:
  • 4338(Human)
• Uniprot:
  • O96033(Human)