MOBKL3 Antibody

Images

 
Immunohistochemistry-Paraffin: MOBKL3 Antibody [NBP2-14535] - Staining of human adrenal gland shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOBKL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDY TRHTLDGAACLLNSNKYFPSRVSIKES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOB4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MOBKL3 Protein (NBP2-14535PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOBKL3 Antibody

  • 2C4D
  • CGI-95
  • Class II mMOB1
  • MOB1
  • MOB1, Mps One Binder kinase activator-like 3 (yeast)
  • MOB1DKFZP564M112
  • Mob3
  • MOB3MGC12264
  • MOB4 MOB family member 4, phocein
  • MOBKL3
  • phocein
  • PHOCN
  • PREI3
  • PREI3mps one binder kinase activator-like 3
  • Preimplantation protein 3Mob1 homolog 3,2C4DCGI-95

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-32051
Species: Hu
Applications: IHC, IHC-P
NBP1-86860
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-84908
Species: Hu
Applications: WB, IHC, IHC-P
NB110-74571
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NB110-74572
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP1-91978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
H00060485-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14535
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MOBKL3 Antibody (NBP2-14535) (0)

There are no publications for MOBKL3 Antibody (NBP2-14535).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOBKL3 Antibody (NBP2-14535) (0)

There are no reviews for MOBKL3 Antibody (NBP2-14535). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MOBKL3 Antibody (NBP2-14535) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOBKL3 Products

Bioinformatics Tool for MOBKL3 Antibody (NBP2-14535)

Discover related pathways, diseases and genes to MOBKL3 Antibody (NBP2-14535). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOBKL3 Antibody (NBP2-14535)

Discover more about diseases related to MOBKL3 Antibody (NBP2-14535).
 

Pathways for MOBKL3 Antibody (NBP2-14535)

View related products by pathway.

Blogs on MOBKL3

There are no specific blogs for MOBKL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOBKL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOB4