HCCA2 Antibody

Immunocytochemistry/Immunofluorescence: HCCA2 Antibody [NBP1-91978] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.

Immunohistochemistry-Paraffin: HCCA2 Antibody [NBP1-91978] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

HCCA2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTISEFCT
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MOB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HCCA2 Protein (NBP1-91978PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HCCA2 Antibody

• HCCA2Mob2 homolog
• Mps one binder kinase activator-like 2

Background

Stimulates the autophosphorylation and kinase activity of STK38 and STK38L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MOB2