MNS1 Antibody

Images

 
Western Blot: MNS1 Antibody [NBP1-83764] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: MNS1 Antibody [NBP1-83764] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MNS1 Antibody [NBP1-83764] - Staining of human testis shows moderate positivity in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MNS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AKEEEENFRKTMLAKFAEDDRIELMNAQKQRMKQLEHRRAVEKLIEERRQQFLADKQRELEEWQLQQRRQGFINAIIEEERLKLLKEHATNLLGYLPKGVFKKEDDIDLLGEEFRKVYQQR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MNS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MNS1 Protein (NBP1-83764PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MNS1 Antibody

  • FLJ11222FLJ26051
  • meiosis-specific nuclear structural 1
  • meiosis-specific nuclear structural protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP1-82802
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-55940
Species: Hu
Applications: ICC/IF
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MNS1 Antibody (NBP1-83764) (0)

There are no publications for MNS1 Antibody (NBP1-83764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MNS1 Antibody (NBP1-83764) (0)

There are no reviews for MNS1 Antibody (NBP1-83764). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MNS1 Antibody (NBP1-83764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MNS1 Products

Bioinformatics Tool for MNS1 Antibody (NBP1-83764)

Discover related pathways, diseases and genes to MNS1 Antibody (NBP1-83764). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MNS1 Antibody (NBP1-83764)

Discover more about diseases related to MNS1 Antibody (NBP1-83764).
 

Pathways for MNS1 Antibody (NBP1-83764)

View related products by pathway.

PTMs for MNS1 Antibody (NBP1-83764)

Learn more about PTMs related to MNS1 Antibody (NBP1-83764).

Blogs on MNS1

There are no specific blogs for MNS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MNS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MNS1