MMR/CD206/Mannose Receptor Antibody (5C11)

Images

 
Western Blot: MMR/CD206/Mannose Receptor Antibody (5C11) [H00004360-M02] - MRC1 monoclonal antibody (M02), clone 5C11. Analysis of MRC1 expression in human pancreas.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (5C11) [H00004360-M02] - Analysis of monoclonal antibody to MRC1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1.5 ug/ml.
ELISA: MMR/CD206/Mannose Receptor Antibody (5C11) [H00004360-M02] - Detection limit for recombinant GST tagged MRC1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Fu, PmSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
5C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MMR/CD206/Mannose Receptor Antibody (5C11) Summary

Immunogen
MRC1 (NP_002429, 22 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY
Specificity
MRC1 (5C11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MRC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 24874253).
Publications
Read Publications using H00004360-M02.

Reactivity Notes

Fungi reactivity reported in scientific literature (PMID: 25506589).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MMR/CD206/Mannose Receptor Antibody (5C11)

  • CD206
  • CLEC13D
  • CLEC13Dmacrophage mannose receptor 1
  • C-type lectin domain family 13 member D
  • mannose receptor, C type 1
  • MMR
  • MMRCD206 antigen
  • MRC1

Background

The recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The protein encoded by this gene is a type I membrane receptor that mediates the endocytosis of glycoproteins by macrophages. The protein has been shown to bind high-mannose structures on the surface of potentially pathogenic viruses, bacteria, and fungi so that they can be neutralized by phagocytic engulfment. This gene is in close proximity to MRC1L1. The gene loci including this gene, MRC1L1, as well as LOC340843 and LOC340893, consist of two nearly identical, tandemly linked genomic regions, which are thought to be a part of a duplicated region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP3-07211
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46459
Species: Hu
Applications: ICC/IF, IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-19417
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13739
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA
AF1626
Species: Hu
Applications: ICC, WB
DY417
Species: Mu
Applications: ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00004360-M02
Species: Hu, Fu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)(16)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 16. Show All 16 Publications.
Publications using H00004360-M02 Applications Species
Numaguchi R, Furuhashi M, Matsumoto M et al. Differential Phenotypes in Perivascular Adipose Tissue Surrounding the Internal Thoracic Artery and Diseased Coronary Artery. J Am Heart Assoc. 2019 Mar 07 [PMID: 30638109]
Ko A, Kang G, Hattler JB et al. Macrophages but not Astrocytes Harbor HIV DNA in the Brains of HIV-1-Infected Aviremic Individuals on Suppressive Antiretroviral Therapy. J Neuroimmune Pharmacol Sep 7 2018 [PMID: 30194646]
Wehrhan F, Buttner-Herold M, Distel L et al. Galectin 3 expression in regional lymph nodes and lymph node metastases of oral squamous cell carcinomas. BMC Cancer Aug 16 2018 [PMID: 30115022]
Nakagawa T, Ohnishi K, Kosaki Y et al. Optimum immunohistochemical procedures for analysis of macrophages in human and mouse formalin fixed paraffin-embedded tissue samples. J Clin Exp Hematop 2017 May 8 [PMID: 28679964]
Weber M, Schlittenbauer T, Moebius P et al. Macrophage polarization differs between apical granulomas, radicular cysts, and dentigerous cysts. Clin Oral Investig 2017 May 13 [PMID: 28501945]
Olmes G, Buttner-Herold M, Ferrazzi F et al. CD163+ M2c-like macrophages predominate in renal biopsies from patients with lupus nephritis. Arthritis Res Ther 2016 Apr 18 [PMID: 27091114]
Weber M, Lliopoulos C, Moebius P et al. Prognostic significance of macrophage polarization in early stage oral squamous cell carcinomas. Oral Oncology 2015 Nov 19 [PMID: 26728105]
Weber M, Moebius P, Buttner-Herold M et al. Macrophage polarisation changes within the time between diagnostic biopsy and tumour resection in oral squamous cell carcinomas-an immunohistochemical study. Br J Cancer. 2015 Jun 25 [PMID: 26110975]
Itano MS, Graus MS, Pehlke C et al. Super-resolution imaging of C-type lectin spatial rearrangement within the dendritic cell plasma membrane at fungal microbe contact sites. Front. Phys. 2014 [PMID: 25506589]
Holder GE, McGary CM, Johnson EM et al. Expression of the Mannose Receptor CD206 in HIV and SIV Encephalitis: A Phenotypic Switch of Brain Perivascular Macrophages with Virus Infection. J Neuroimmune Pharmacol. 2014 Aug 22 [PMID: 25146376]
Show All 16 Publications.

Reviews for MMR/CD206/Mannose Receptor Antibody (H00004360-M02) (0)

There are no reviews for MMR/CD206/Mannose Receptor Antibody (H00004360-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MMR/CD206/Mannose Receptor Antibody (H00004360-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMR/CD206/Mannose Receptor Products

Bioinformatics Tool for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)

Discover related pathways, diseases and genes to MMR/CD206/Mannose Receptor Antibody (H00004360-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)

Discover more about diseases related to MMR/CD206/Mannose Receptor Antibody (H00004360-M02).
 

Pathways for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)

View related products by pathway.

PTMs for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)

Learn more about PTMs related to MMR/CD206/Mannose Receptor Antibody (H00004360-M02).
 

Research Areas for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)

Find related products by research area.

Blogs on MMR/CD206/Mannose Receptor.

Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMR/CD206/Mannose Receptor Antibody (5C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol MRC1
Entrez
OMIM
Uniprot