MMR/CD206/Mannose Receptor Antibody (5C11)

Images

 
Western Blot: MMR/CD206/Mannose Receptor Antibody (5C11) [H00004360-M02] - MRC1 monoclonal antibody (M02), clone 5C11. Analysis of MRC1 expression in human pancreas.
Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody (5C11) [H00004360-M02] - Analysis of monoclonal antibody to MRC1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1.5 ug/ml.
ELISA: MMR/CD206/Mannose Receptor Antibody (5C11) [H00004360-M02] - Detection limit for recombinant GST tagged MRC1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, FuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
5C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MMR/CD206/Mannose Receptor Antibody (5C11) Summary

Immunogen
MRC1 (NP_002429, 22 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY
Specificity
MRC1 (5C11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MRC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.
Publications
Read Publications using H00004360-M02.

Reactivity Notes

Fungi reactivity reported in scientific literature (PMID: 25506589).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MMR/CD206/Mannose Receptor Antibody (5C11)

  • CD206
  • CLEC13D
  • CLEC13Dmacrophage mannose receptor 1
  • C-type lectin domain family 13 member D
  • mannose receptor, C type 1
  • MMR
  • MMRCD206 antigen
  • MRC1

Background

The recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The protein encoded by this gene is a type I membrane receptor that mediates the endocytosis of glycoproteins by macrophages. The protein has been shown to bind high-mannose structures on the surface of potentially pathogenic viruses, bacteria, and fungi so that they can be neutralized by phagocytic engulfment. This gene is in close proximity to MRC1L1. The gene loci including this gene, MRC1L1, as well as LOC340843 and LOC340893, consist of two nearly identical, tandemly linked genomic regions, which are thought to be a part of a duplicated region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56552
Species: Hu
Applications: WB
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB100-56554
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58368
Species: Hu
Applications: ICC/IF
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF4885
Species: Mu
Applications: WB, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)(11)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using H00004360-M02 Applications Species
Olmes G, Buttner-Herold M, Ferrazzi F et al. CD163+ M2c-like macrophages predominate in renal biopsies from patients with lupus nephritis. Arthritis Res Ther 2016 Apr 18 [PMID: 27091114]
Weber M, Lliopoulos C, Moebius P et al. Prognostic significance of macrophage polarization in early stage oral squamous cell carcinomas. Oral Oncology 2015 Nov 19 [PMID: 26728105]
Weber M, Moebius P, Buttner-Herold M et al. Macrophage polarisation changes within the time between diagnostic biopsy and tumour resection in oral squamous cell carcinomas-an immunohistochemical study. Br J Cancer. 2015 Jun 25 [PMID: 26110975]
Itano MS, Graus MS, Pehlke C et al. Super-resolution imaging of C-type lectin spatial rearrangement within the dendritic cell plasma membrane at fungal microbe contact sites. Front. Phys. 2014 [PMID: 25506589]
Holder GE, McGary CM, Johnson EM et al. Expression of the Mannose Receptor CD206 in HIV and SIV Encephalitis: A Phenotypic Switch of Brain Perivascular Macrophages with Virus Infection. J Neuroimmune Pharmacol. 2014 Aug 22 [PMID: 25146376]
Wehrhan F, Buttner-Herold M, Hyckel P et al. Increased malignancy of oral squamous cell carcinomas (oscc) is associated with macrophage polarization in regional lymph nodes - an immunohistochemical study. BMC Cancer. 2014 Jul 21 [PMID: 25042135]
Graus Matthew S, Pehlke Carolyn, Wester Michael J et al. A new tool to quantify receptor recruitment to cell contact sites during host-pathogen interaction. PLoS Comput Biol. 2014 May 29 [PMID: 24874253] (ICC/IF) ICC/IF
Weber M, Buttner-Herold M, Hyckel P et al. Small oral squamous cell carcinomas with nodal lymphogenic metastasis show increased infiltration of M2 polarized macrophages - an immunohistochemical analysis. Journal of Cranio-Maxillofacial Surgery. 2014 [PMID: 24556525]
Canna SW, Costa-Reis P, Bernal WE et al. Alternative activation of laser-captured murine hemophagocytes. Arthritis Rheumatol. 2014 Jan 27 [PMID: 24470386]
Zhuang PY, Zhu MJ, Wang JD et al. Xanthogranulomatous cholecystitis: A clinicopathological study of its association with gallbladder carcinoma. J Dig Dis. 2012 Sep 21 [PMID: 23134201]
Show All 11 Publications.

Reviews for MMR/CD206/Mannose Receptor Antibody (H00004360-M02) (0)

There are no reviews for MMR/CD206/Mannose Receptor Antibody (H00004360-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMR/CD206/Mannose Receptor Antibody (H00004360-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMR/CD206/Mannose Receptor Products

Bioinformatics Tool for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)

Discover related pathways, diseases and genes to MMR/CD206/Mannose Receptor Antibody (H00004360-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)

Discover more about diseases related to MMR/CD206/Mannose Receptor Antibody (H00004360-M02).
 

Pathways for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)

View related products by pathway.

PTMs for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)

Learn more about PTMs related to MMR/CD206/Mannose Receptor Antibody (H00004360-M02).
 

Research Areas for MMR/CD206/Mannose Receptor Antibody (H00004360-M02)

Find related products by research area.

Blogs on MMR/CD206/Mannose Receptor

There are no specific blogs for MMR/CD206/Mannose Receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMR/CD206/Mannose Receptor Antibody (5C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol MRC1
Entrez
OMIM
Uniprot