MMP23B Antibody - BSA Free

Western Blot: MMP23B Antibody [NBP1-60036] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MMP23B Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MMP23B(matrix metallopeptidase 23B) The peptide sequence was selected from the middle region of MMP23B. Peptide sequence QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MMP23B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MMP23B Antibody - BSA Free

• EC 3.4.24.-
• Femalysin
• matrix metallopeptidase 23B
• matrix metalloproteinase 22
• matrix metalloproteinase 23B
• matrix metalloproteinase in the female reproductive tract
• Matrix metalloproteinase-21
• Matrix metalloproteinase-22
• matrix metalloproteinase-23
• MIFR
• MIFR-1
• MIFR-1MMP22femalysin
• MMP21
• MMP-21
• MMP22
• MMP-22
• MMP-23
• MMP23A
• MMP23B

Background

MMP23B is a protease.This gene (MMP23B) encodes a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. This gene belongs to the more telomeric copy of the duplicated region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MMP23B
• Uniprot:
  • O75900(Human)