MMP-8 Antibody - BSA Free

Immunohistochemistry-Paraffin: MMP-8 Antibody [NBP1-85577] - Staining of human placenta shows low expression as expected.

Immunohistochemistry-Paraffin: MMP-8 Antibody [NBP1-85577] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: MMP-8 Antibody [NBP1-85577] - Staining in human bone marrow and placenta tissues using anti-MMP8 antibody. Corresponding MMP8 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MMP-8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MMP8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MMP-8 Protein (NBP1-85577PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MMP-8 Antibody - BSA Free

• CLG1HNC
• Collagenase 2
• EC 3.4.24
• EC 3.4.24.34
• matrix metallopeptidase 8 (neutrophil collagenase)
• matrix metalloproteinase 8 (neutrophil collagenase)
• Matrix metalloproteinase-8
• MMP8
• MMP-8
• neutrophil collagenase
• PMNL collagenase
• PMNL-CL

Background

MMP8 is a Metallopeptidase M10A type protease. MMP8 is a Metallopeptidase M10A type protease. It is synthesized and stored intracellularly in specific granules in neutrophils. MMP8 shows a preference for degrading type I collagen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MMP8