MMP-3 Recombinant Protein Antigen

Images

 
There are currently no images for MMP-3 Protein (NBP1-82431PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MMP-3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP3.

Source: E. coli

Amino Acid Sequence: MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MMP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82431.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MMP-3 Recombinant Protein Antigen

  • CHDS6
  • EC 3.4.24
  • EC 3.4.24.17
  • matrix metallopeptidase 3 (stromelysin 1, progelatinase)
  • matrix metalloproteinase 3 (stromelysin 1, progelatinase)
  • Matrix metalloproteinase-3
  • MGC126102
  • MGC126103
  • MMP3
  • MMP-3
  • proteoglycanase
  • SL-1
  • STMY
  • STMY1MGC126104
  • STR1
  • Stromelysin 1
  • stromelysin-1
  • transin-1

Background

Effective inhibitors of matrix metalloproteinases (MMPs), a family of connective tissue-degrading enzymes, could be useful for the treatment of diseases such as cancer, multiple sclerosis, and arthritis (1). Matrix metalloproteinase-3 (MMP-3) is a protein involved in tumor invasion and metastasis. MMP3 (stromelysin) is a secreted metalloprotease with a wide range of substrate specificities. MMP3 is synthesized in a preproenzyme form with a calculated size of 54 kDa and a 17-amino acid long signal peptide. Data indicate that the expression and the possible involvement of secreted metalloproteases in tumorigenesis result from a specific interaction between the transforming factor and the target cell, which may vary in different species (2). In neural studies, matrix metalloproteinase-3 (MMP-3) was newly induced and activated in stressed dopamine cells, and the active form of MMP-3 (actMMP-3) was released into the medium. The released actMMP-3, as well as catalytically active recombinant MMP-3 (cMMP-3) led to microglial activation and superoxide generation in microglia and enhanced DA cell death. (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
DTM100
Species: Hu
Applications: ELISA
DMP900
Species: Hu
Applications: ELISA
MAB901
Species: Hu
Applications: IHC, IP, KO, Neut, WB
DM1300
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
DTM200
Species: Hu
Applications: ELISA
DMP700
Species: Hu
Applications: ELISA
DY1707
Species: Hu
Applications: ELISA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
201-LB
Species: Hu
Applications: BA
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DM1000
Species: Hu
Applications: ELISA
MAB9181
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
NBP1-82431PEP
Species: Hu
Applications: AC

Publications for MMP-3 Protein (NBP1-82431PEP) (0)

There are no publications for MMP-3 Protein (NBP1-82431PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-3 Protein (NBP1-82431PEP) (0)

There are no reviews for MMP-3 Protein (NBP1-82431PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MMP-3 Protein (NBP1-82431PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MMP-3 Products

Research Areas for MMP-3 Protein (NBP1-82431PEP)

Find related products by research area.

Blogs on MMP-3.

MMP3 - a potential target for arthritis therapies
Matrix metalloproteinases (MMPs) are responsible for the degradation of extracellular matrix proteins. MMPs are essential for tissue remodeling during normal processes such as embryonic development as well as pathological conditions such as arthri...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MMP-3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP3