MMP-3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MMP-3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP3.
  
  

  Source: E. coli

  Amino Acid Sequence: MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MMP3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82431.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MMP-3 Recombinant Protein Antigen

• CHDS6
• EC 3.4.24
• EC 3.4.24.17
• matrix metallopeptidase 3 (stromelysin 1, progelatinase)
• matrix metalloproteinase 3 (stromelysin 1, progelatinase)
• Matrix metalloproteinase-3
• MGC126102
• MGC126103
• MMP3
• MMP-3
• proteoglycanase
• SL-1
• STMY
• STMY1MGC126104
• STR1
• Stromelysin 1
• stromelysin-1
• transin-1

Background

Effective inhibitors of matrix metalloproteinases (MMPs), a family of connective tissue-degrading enzymes, could be useful for the treatment of diseases such as cancer, multiple sclerosis, and arthritis (1). Matrix metalloproteinase-3 (MMP-3) is a protein involved in tumor invasion and metastasis. MMP3 (stromelysin) is a secreted metalloprotease with a wide range of substrate specificities. MMP3 is synthesized in a preproenzyme form with a calculated size of 54 kDa and a 17-amino acid long signal peptide. Data indicate that the expression and the possible involvement of secreted metalloproteases in tumorigenesis result from a specific interaction between the transforming factor and the target cell, which may vary in different species (2). In neural studies, matrix metalloproteinase-3 (MMP-3) was newly induced and activated in stressed dopamine cells, and the active form of MMP-3 (actMMP-3) was released into the medium. The released actMMP-3, as well as catalytically active recombinant MMP-3 (cMMP-3) led to microglial activation and superoxide generation in microglia and enhanced DA cell death. (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MMP3