MMP-24/MT5-MMP Antibody

Images

 
Western Blot: MMP24 Antibody [NBP1-59458] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMP-24/MT5-MMP Antibody Summary

Immunogen
Synthetic peptides corresponding to MMP24(matrix metallopeptidase 24 (membrane-inserted)) The peptide sequence was selected from the middle region of MMP24 (NP_006681). Peptide sequence GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMP24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MMP24 and was validated on Western blot.
Control
MMP-24/MT5-MMP Knockout HeLa Cell Lysate
Publications
Read Publication using NBP1-59458.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MMP-24/MT5-MMP Antibody

  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.80
  • matrix metallopeptidase 24 (membrane-inserted)
  • matrix metalloproteinase 24 (membrane-inserted)
  • matrix metalloproteinase-24
  • membrane-type 5 matrix metalloproteinase
  • Membrane-type matrix metalloproteinase 5
  • Membrane-type-5 matrix metalloproteinase
  • MMP24
  • MMP-24
  • MT5MMP
  • MT5-MMP
  • MT5-MMPMMP25
  • MT-MMP 5
  • MTMMP5
  • MT-MMP5

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67415
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MMP200
Species: Hu, Mu, Rt, Po, Ca
NBP2-75574
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1785
Species: Hu
Applications: WB, IHC, IP
MAB9161
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF6790
Species: Hu
Applications: WB, IHC
NBP2-67670
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, B/N
H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-49584
Species: Hu
Applications: IHC, IHC-P
NBP1-59458
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for MMP-24/MT5-MMP Antibody (NBP1-59458)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-59458 Applications Species
Ross,HH. FEBS Lett. 581 (30), 5923-5928. 2007 [PMID: 18062926]

Reviews for MMP-24/MT5-MMP Antibody (NBP1-59458) (0)

There are no reviews for MMP-24/MT5-MMP Antibody (NBP1-59458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMP-24/MT5-MMP Antibody (NBP1-59458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MMP-24/MT5-MMP Products

Bioinformatics Tool for MMP-24/MT5-MMP Antibody (NBP1-59458)

Discover related pathways, diseases and genes to MMP-24/MT5-MMP Antibody (NBP1-59458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-24/MT5-MMP Antibody (NBP1-59458)

Discover more about diseases related to MMP-24/MT5-MMP Antibody (NBP1-59458).
 

Pathways for MMP-24/MT5-MMP Antibody (NBP1-59458)

View related products by pathway.

PTMs for MMP-24/MT5-MMP Antibody (NBP1-59458)

Learn more about PTMs related to MMP-24/MT5-MMP Antibody (NBP1-59458).

Blogs on MMP-24/MT5-MMP

There are no specific blogs for MMP-24/MT5-MMP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP-24/MT5-MMP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP24
Entrez
Uniprot