MMP-19 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to MMP19 (matrix metallopeptidase 19) The peptide sequence was selected from the N terminal of MMP19. Peptide sequence ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MMP19 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for MMP-19 Antibody - BSA Free
Background
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of MMP-19 has not been determined. This gene corresponding to this protein was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19). Multiple transcript variants encoding distict isoforms have been identified for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, KO, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Publications for MMP-19 Antibody (NBP1-57092) (0)
There are no publications for MMP-19 Antibody (NBP1-57092).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MMP-19 Antibody (NBP1-57092) (0)
There are no reviews for MMP-19 Antibody (NBP1-57092).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MMP-19 Antibody (NBP1-57092) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MMP-19 Products
Research Areas for MMP-19 Antibody (NBP1-57092)
Find related products by research area.
|
Blogs on MMP-19