MMP-15/MT2-MMP Antibody

Images

 
Immunohistochemistry: MMP15 Antibody [NBP2-32613] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMP-15/MT2-MMP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMP15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MMP-15/MT2-MMP Protein (NBP2-32613PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMP-15/MT2-MMP Antibody

  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.80
  • matrix metallopeptidase 15 (membrane-inserted)
  • matrix metalloproteinase 15 (membrane-inserted)
  • Membrane-type matrix metalloproteinase 2
  • Membrane-type-2 matrix metalloproteinase
  • MMP15
  • MMP-15
  • MT2-MMP
  • MT2-MMPMT2MMP
  • MTMMP2MT-MMP 2
  • SMCP-2matrix metalloproteinase-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF1785
Species: Hu
Applications: WB, IHC, IP
MAB7796
Species: Hu
Applications: Neut
AF972
Species: Hu
Applications: WB, Simple Western, IHC
MAB3657
Species: Hu
Applications: CyTOF-ready, ICFlow
AB924
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-28912
Species: Hu
Applications: WB, PEP-ELISA
NBP2-32613
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MMP-15/MT2-MMP Antibody (NBP2-32613) (0)

There are no publications for MMP-15/MT2-MMP Antibody (NBP2-32613).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-15/MT2-MMP Antibody (NBP2-32613) (0)

There are no reviews for MMP-15/MT2-MMP Antibody (NBP2-32613). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MMP-15/MT2-MMP Antibody (NBP2-32613) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP-15/MT2-MMP Products

Bioinformatics Tool for MMP-15/MT2-MMP Antibody (NBP2-32613)

Discover related pathways, diseases and genes to MMP-15/MT2-MMP Antibody (NBP2-32613). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-15/MT2-MMP Antibody (NBP2-32613)

Discover more about diseases related to MMP-15/MT2-MMP Antibody (NBP2-32613).
 

Pathways for MMP-15/MT2-MMP Antibody (NBP2-32613)

View related products by pathway.

PTMs for MMP-15/MT2-MMP Antibody (NBP2-32613)

Learn more about PTMs related to MMP-15/MT2-MMP Antibody (NBP2-32613).
 

Research Areas for MMP-15/MT2-MMP Antibody (NBP2-32613)

Find related products by research area.

Blogs on MMP-15/MT2-MMP

There are no specific blogs for MMP-15/MT2-MMP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP-15/MT2-MMP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP15
Entrez