MMP-15/MT2-MMP Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MMP15 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MMP-15/MT2-MMP Antibody - BSA Free
Background
MMPs are a group of enzymes involved in matrix degradation. Of the sixteen members of matrix metalloproteinase family ten exist in soluble form whereas MT MMPs exist as integral membrane proteins. MT1 MMp, MT2 MMP and MT3 MMP also known as MMP 14, MMP 15 and MMP 16 respectively. They contain a C-terminal transmembrane domain anchoring them to the cell surface. MT2 MMP plays a minor role in activation of pro-MMP 2 to its active form in breast carcinomas. Coexpression of MT1 MMP and MT2 MMP in advanced stages of breast carcinomas is indicative of possible involvement of MT2 MMP in its metastasis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: InhibAct
Species: Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: IHC
Publications for MMP-15/MT2-MMP Antibody (NBP2-32613) (0)
There are no publications for MMP-15/MT2-MMP Antibody (NBP2-32613).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MMP-15/MT2-MMP Antibody (NBP2-32613) (0)
There are no reviews for MMP-15/MT2-MMP Antibody (NBP2-32613).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MMP-15/MT2-MMP Antibody (NBP2-32613) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MMP-15/MT2-MMP Products
Research Areas for MMP-15/MT2-MMP Antibody (NBP2-32613)
Find related products by research area.
|
Blogs on MMP-15/MT2-MMP