MMP-14/MT1-MMP Antibody (6T7L3) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MMP-14/MT1-MMP (P50281). GAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
MMP14 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for MMP-14/MT1-MMP Antibody (6T7L3)
Background
The matrix metalloproteinase (MMP) family (approximately 25 members in mammals) has been implicated in extracellular matrix remodeling associated with embryonic development, cancer formation and progression, and various other physiological and pathological events. MMP-14 is a membrane-bound matrix metalloproteinase (MT-MMP) capable of mediating pericellular proteolysis of extracellular matrix components. MMP-14 is therefore thought to be an important molecular tool for cellular remodeling of the surrounding matrix (1). Gelatinase A (type-IV collagenase; M(r) 72,000) is produced by tumour stroma cells and is believed to be crucial for their invasion and metastasis, acting by degrading extracellular matrix macro-molecules such as type IV collagen. MMP-14 may thus trigger invasion by tumor cells by activating pro-gelatinase A on the tumor cell surface (2). Observations identify MT1-MMP as a tumor-derived growth factor that regulates proliferation by controlling cell geometry within the confines of the 3D extracellular matrix (ECM) (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IP, KO, Neut, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Publications for MMP-14/MT1-MMP Antibody (NBP3-15247) (0)
There are no publications for MMP-14/MT1-MMP Antibody (NBP3-15247).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MMP-14/MT1-MMP Antibody (NBP3-15247) (0)
There are no reviews for MMP-14/MT1-MMP Antibody (NBP3-15247).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MMP-14/MT1-MMP Antibody (NBP3-15247) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MMP-14/MT1-MMP Products
Research Areas for MMP-14/MT1-MMP Antibody (NBP3-15247)
Find related products by research area.
|
Blogs on MMP-14/MT1-MMP