MMP-14/MT1-MMP Antibody (6T7L3)

Western Blot: MMP-14/MT1-MMP Antibody (6T7L3) [NBP3-15247] - Western blot analysis of extracts of various cell lines, using MMP14/MMP-14/MT1-MMP Rabbit mAb (NBP3-15247) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Western Blot: MMP-14/MT1-MMP Antibody (6T7L3) [NBP3-15247] - Western blot analysis of extracts of various cell lines, using MMP14/MMP-14/MT1-MMP Rabbit mAb (NBP3-15247) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using MMP-14/MT1-MMP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using MMP-14/MT1-MMP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Flow cytometry: 1X10^6 MCF7 cells (negative control,left) and HT-1080 cells were intracellularly-stained with MMP-14/MT1-MMP Rabbit mAb or ABflo 488 Rabbit IgG isotype control , followed by Alexa Fluor 488 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control .

Immunohistochemistry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using MMP-14/MT1-MMP Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Flow cytometry: 1X10^6 MCF7 cells (negative control,left) and HT-1080 cells were intracellularly-stained with MMP-14/MT1-MMP Rabbit mAb or ABflo 647 Rabbit IgG isotype control , followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control .

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Flow cytometry: 1X10^6 MCF7 cells (negative control,left) and HT-1080 cells were intracellularly-stained with MMP-14/MT1-MMP Rabbit mAb or ABflo 647 Rabbit IgG isotype control , followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control .

Flow Cytometry: MMP-14/MT1-MMP Antibody (6T7L3) [MMP-14/MT1-MMP] - Flow cytometry: 1X10^6 MCF7 cells (negative control,left) and HT-1080 cells were intracellularly-stained with MMP-14/MT1-MMP Rabbit mAb or ABflo 488 Rabbit IgG isotype control , followed by Alexa Fluor 488 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control .

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 6T7L3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MMP-14/MT1-MMP Antibody (6T7L3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MMP-14/MT1-MMP (P50281). GAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MMP14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MMP-14/MT1-MMP Antibody (6T7L3)

• EC 3.4.24
• EC 3.4.24.80
• matrix metallopeptidase 14 (membrane-inserted)
• matrix metalloproteinase 14 (membrane-inserted)
• matrix metalloproteinase-14
• membrane type 1 metalloprotease
• Membrane-type matrix metalloproteinase 1
• Membrane-type-1 matrix metalloproteinase
• MMP14
• MMP-14
• MMP-X1
• MT1MMP
• MT1-MMP
• MT1-MMPMTMMP1
• MT-MMP 1
• MT-MMP1

Background

The matrix metalloproteinase (MMP) family (approximately 25 members in mammals) has been implicated in extracellular matrix remodeling associated with embryonic development, cancer formation and progression, and various other physiological and pathological events. MMP-14 is a membrane-bound matrix metalloproteinase (MT-MMP) capable of mediating pericellular proteolysis of extracellular matrix components. MMP-14 is therefore thought to be an important molecular tool for cellular remodeling of the surrounding matrix (1). Gelatinase A (type-IV collagenase; M(r) 72,000) is produced by tumour stroma cells and is believed to be crucial for their invasion and metastasis, acting by degrading extracellular matrix macro-molecules such as type IV collagen. MMP-14 may thus trigger invasion by tumor cells by activating pro-gelatinase A on the tumor cell surface (2). Observations identify MT1-MMP as a tumor-derived growth factor that regulates proliferation by controlling cell geometry within the confines of the 3D extracellular matrix (ECM) (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MMP14