MIST1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MIST1 Antibody [NBP2-30979] - Staining of human cell line Hep G2 shows localization to nucleoplasm & the Golgi apparatus.

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979] - Staining in human pancreas and skeletal muscle tissues . Corresponding BHLHA15 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979] - Staining of human stomach shows moderate to strong nuclear positivity in a subset of glandular cells.

Immunohistochemistry-Paraffin: MIST1 Antibody [NBP2-30979] - Staining of human tonsil shows moderate to strong nuclear positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MIST1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AKNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BHLHA15
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MIST1 Protein (NBP2-30979PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MIST1 Antibody - BSA Free

• basic helix-loop-helix domain containing, class B, 8
• basic helix-loop-helix family, member a15
• bHLHa15
• BHLHB8
• class A basic helix-loop-helix protein 15
• Class B basic helix-loop-helix protein 8
• class II bHLH protein MIST1
• MIST1MIST-1
• Muscle, intestine and stomach expression 1

Background

MIST1 plays a role in controlling the transcriptional activity of MYOD1, ensuring that expanding myoblastpopulations remain undifferentiated. Repression may occur through muscle-specific E-box occupancy by homodimers. Mayalso negatively regulate bHLH-mediated t

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BHLHA15
• Uniprot:
  • Q7RTS1(Human)