MINDY3 Antibody - BSA Free

Western Blot: FAM188A Antibody [NBP3-10668] - Western blot analysis of FAM188A in Rat Lung lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MINDY3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MINDY3 Antibody - BSA Free (NBP3-10668) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fam188a (NP_001099592). Peptide sequence CAVIAPVQAFLLKKLLFSSEKSSWRDCSEDEQKELLCHTLCDILESACDS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MINDY3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MINDY3 Antibody - BSA Free

• C10orf97
• C10orf97caspase recruitment domain containing pro-apoptotic protein
• CARPRP11-394I23.1
• chromosome 10 open reading frame 97
• Dermal papilla-derived protein 5
• DERP5CARD-containing protein
• FAM188A
• family with sequence similarity 188, member A
• FLJ13397
• MINDY3
• MST126
• MSTP126
• My042
• Protein CARP

Background

FAM188A is a member of the caspase-associated recruitment domain (CARD) family of proteins that play a role in apoptosis (Liu et al., 2002 [PubMed 12054670]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MINDY3