Mind Bomb 1/MIB1 Antibody (9Q4N9)

Western Blot: Mind Bomb 1/MIB1 Antibody (9Q4N9) [NBP3-16175] - Western blot analysis of extracts of various cell lines, using Mind Bomb 1/MIB1 Rabbit mAb (NBP3-16175) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 9Q4N9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Mind Bomb 1/MIB1 Antibody (9Q4N9) Summary

• Description: Novus Biologicals Rabbit Mind Bomb 1/MIB1 Antibody (9Q4N9) (NBP3-16175) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Mind Bomb 1/MIB1 (Q86YT6). MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKC
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MIB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Mind Bomb 1/MIB1 Antibody (9Q4N9)

• DAPK-interacting protein 1
• DIP1
• DIP-1FLJ90676
• DKFZp686I0769
• DKFZp761M1710
• E3 ubiquitin-protein ligase MIB1
• EC 6.3.2
• EC 6.3.2.-
• KIAA1323
• MGC129660
• MIB
• MIB1
• Mind Bomb 1
• Mind bomb homolog 1
• mindbomb homolog 1 (Drosophila)
• ubiquitin ligase mind bomb
• ubiquitin ligase protein MIB1
• Zinc finger ZZ type with ankyrin repeat domain protein 2
• ZZANK2
• ZZANK2MGC129659
• ZZZ6

Background

E3 ubiquitin ligase protein mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. It positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. It probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MIB1