MINA Antibody

Images

 
Western Blot: MINA Antibody [NBP1-89863] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: MINA Antibody [NBP1-89863] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: MINA Antibody [NBP1-89863] - Staining of human thyroid gland shows nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MINA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDDPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MINA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MINA Protein (NBP1-89863PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MINA Antibody

  • DKFZp762O1912
  • FLJ14393
  • MDIG
  • MDIGDKFZp762O1912
  • MINA
  • Mina53
  • MINA53mdig
  • mineral dust induced gene protein
  • Mineral dust-induced gene protein
  • MYC induced nuclear antigen
  • MYC-induced nuclear antigen
  • myc-induced nuclear antigen, 53 kDa
  • NO52
  • Nucleolar protein 52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00079697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MINA Antibody (NBP1-89863) (0)

There are no publications for MINA Antibody (NBP1-89863).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MINA Antibody (NBP1-89863) (0)

There are no reviews for MINA Antibody (NBP1-89863). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MINA Antibody (NBP1-89863) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MINA Products

Bioinformatics Tool for MINA Antibody (NBP1-89863)

Discover related pathways, diseases and genes to MINA Antibody (NBP1-89863). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MINA Antibody (NBP1-89863)

Discover more about diseases related to MINA Antibody (NBP1-89863).
 

Pathways for MINA Antibody (NBP1-89863)

View related products by pathway.

PTMs for MINA Antibody (NBP1-89863)

Learn more about PTMs related to MINA Antibody (NBP1-89863).

Blogs on MINA

There are no specific blogs for MINA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MINA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MINA
Entrez