MIF4GD Antibody


Western Blot: MIF4GD Antibody [NBP2-30627] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Tonsil
Immunocytochemistry/ Immunofluorescence: MIF4GD Antibody [NBP2-30627] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & cytosol.
Immunohistochemistry: MIF4GD Antibody [NBP2-30627] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MIF4GD Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGL
Specificity of human MIF4GD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MIF4GD Protein (NBP2-30627PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MIF4GD Antibody

  • AD023
  • hSLIP1
  • MGC45027
  • MIF4G domain containing
  • MIFD
  • SLBP (stem loop binding protein)-interacting protein 1
  • SLBP-interacting protein 1
  • SLIP1MIF4G domain-containing protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MIF4GD Antibody (NBP2-30627) (0)

There are no publications for MIF4GD Antibody (NBP2-30627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIF4GD Antibody (NBP2-30627) (0)

There are no reviews for MIF4GD Antibody (NBP2-30627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MIF4GD Antibody (NBP2-30627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MIF4GD Products

Bioinformatics Tool for MIF4GD Antibody (NBP2-30627)

Discover related pathways, diseases and genes to MIF4GD Antibody (NBP2-30627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIF4GD Antibody (NBP2-30627)

Discover more about diseases related to MIF4GD Antibody (NBP2-30627).

Pathways for MIF4GD Antibody (NBP2-30627)

View related products by pathway.

PTMs for MIF4GD Antibody (NBP2-30627)

Learn more about PTMs related to MIF4GD Antibody (NBP2-30627).

Blogs on MIF4GD

There are no specific blogs for MIF4GD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MIF4GD Antibody and receive a gift card or discount.


Gene Symbol MIF4GD