MIF4GD Antibody

Images

 
Western Blot: MIF4GD Antibody [NBP2-30627] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Tonsil
Immunocytochemistry/ Immunofluorescence: MIF4GD Antibody [NBP2-30627] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & cytosol.
Immunohistochemistry: MIF4GD Antibody [NBP2-30627] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MIF4GD Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIF4GD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MIF4GD Protein (NBP2-30627PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MIF4GD Antibody

  • AD023
  • hSLIP1
  • MGC45027
  • MIF4G domain containing
  • MIFD
  • SLBP (stem loop binding protein)-interacting protein 1
  • SLBP-interacting protein 1
  • SLIP1MIF4G domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007884-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87947
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84869
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5458
Species: Hu
Applications: WB, ICC
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
46530002
Species: Hu
Applications: ELISA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-85302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-17058
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33726
Species: Hu
Applications: IHC, IHC-P
NBP1-90454
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-30627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MIF4GD Antibody (NBP2-30627) (0)

There are no publications for MIF4GD Antibody (NBP2-30627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIF4GD Antibody (NBP2-30627) (0)

There are no reviews for MIF4GD Antibody (NBP2-30627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MIF4GD Antibody (NBP2-30627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MIF4GD Products

Bioinformatics Tool for MIF4GD Antibody (NBP2-30627)

Discover related pathways, diseases and genes to MIF4GD Antibody (NBP2-30627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIF4GD Antibody (NBP2-30627)

Discover more about diseases related to MIF4GD Antibody (NBP2-30627).
 

Pathways for MIF4GD Antibody (NBP2-30627)

View related products by pathway.

PTMs for MIF4GD Antibody (NBP2-30627)

Learn more about PTMs related to MIF4GD Antibody (NBP2-30627).

Blogs on MIF4GD

There are no specific blogs for MIF4GD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIF4GD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIF4GD
Uniprot