![Immunohistochemistry-Paraffin: STARD9 Antibody [NBP1-82917] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.](http://images.novusbio.com/fullsize2/STARD9-Antibody-Immunohistochemistry-Paraffin-NBP1-82917-img0005.jpg "Immunohistochemistry-Paraffin: STARD9 Antibody [NBP1-82917] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GMYSEPLRQFRDSSVGDQNAQVCQTNPEPPATTQGPHTLDLSEGSAESKLVVEPQHECLENTTRCFLEKPQFSTELRDHNRLDSQAKFVARLKHTCSPQEDSPWQEEEQHRDQASGGGE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STARD9 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
---Azide-and-BSA-Free-Western-Blot-NBP2-72685-img0001.jpg)
---Azide-and-BSA-Free-Flow-Cytometry-NBP2-72685-img0002.jpg)
---Azide-and-BSA-Free-Flow-Cytometry-NBP2-72685-img0003.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for STARD9 Antibody (NBP1-82917)Discover more about diseases related to STARD9 Antibody (NBP1-82917).
| Pathways for STARD9 Antibody (NBP1-82917)View related products by pathway.
|
PTMs for STARD9 Antibody (NBP1-82917)Learn more about PTMs related to STARD9 Antibody (NBP1-82917).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STARD9 |
-Western-Blot-H00002316-M01-img0009.jpg)
-ELISA-H00002316-M01-img0008.jpg)
-Proximity-Ligation-Assay-H00002316-M01-img0005.jpg)
-Immunocytochemistry-Immunofluorescence-H00004957-M01-img0005.jpg)
-Western-Blot-H00004957-M01-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-H00004957-M01-img0004.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")