STARD9 Antibody

Images

 
Immunohistochemistry-Paraffin: STARD9 Antibody [NBP1-82917] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STARD9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GMYSEPLRQFRDSSVGDQNAQVCQTNPEPPATTQGPHTLDLSEGSAESKLVVEPQHECLENTTRCFLEKPQFSTELRDHNRLDSQAKFVARLKHTCSPQEDSPWQEEEQHRDQASGGGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STARD9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STARD9 Protein (NBP1-82917PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STARD9 Antibody

  • DKFZp686O248
  • DKFZp686P19131
  • DKFZp781J069
  • FLJ16106
  • FLJ21936
  • KIAA1300
  • StAR-related lipid transfer (START) domain containing 9
  • stAR-related lipid transfer protein 9
  • START domain containing 9
  • START domain-containing protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87947
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56073
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90454
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5458
Species: Hu
Applications: WB, ICC
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NBP1-87514
Species: Hu
Applications: IHC, IHC-P
H00004957-M01
Species: Hu, Ce
Applications: WB, ELISA, ICC/IF, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-46837
Species: Hu, Mu
Applications: WB, IP
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-90443
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81512
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82917
Species: Hu
Applications: IHC, IHC-P

Publications for STARD9 Antibody (NBP1-82917) (0)

There are no publications for STARD9 Antibody (NBP1-82917).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD9 Antibody (NBP1-82917) (0)

There are no reviews for STARD9 Antibody (NBP1-82917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STARD9 Antibody (NBP1-82917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STARD9 Products

STARD9 NBP1-82917

Bioinformatics Tool for STARD9 Antibody (NBP1-82917)

Discover related pathways, diseases and genes to STARD9 Antibody (NBP1-82917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STARD9 Antibody (NBP1-82917)

Discover more about diseases related to STARD9 Antibody (NBP1-82917).
 

Pathways for STARD9 Antibody (NBP1-82917)

View related products by pathway.

PTMs for STARD9 Antibody (NBP1-82917)

Learn more about PTMs related to STARD9 Antibody (NBP1-82917).

Blogs on STARD9

There are no specific blogs for STARD9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STARD9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD9