We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Midkine Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Midkine Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-55458PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Midkine Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Midkine.

Source: E. coli

Amino Acid Sequence: DCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MDK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55458.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Midkine Recombinant Protein Antigen

  • Amphiregulin-associated protein
  • ARAP
  • MDK
  • MEK
  • Midgestation and kidney protein
  • midkine (neurite growth-promoting factor 2)
  • Midkine
  • MK1
  • MKARAP
  • NEGF2
  • NEGF2FLJ27379
  • Neurite outgrowth-promoting factor 2
  • Neurite outgrowth-promoting protein

Background

Midkine (MK) is a 13 kDa heparin-binding polypeptide which enhances neurite outgrowth, neuronal cell survival and plasminogen activator activity. MK is structurally divided into two domains, and most of the biological activities are located on the C-terminal domain. Both domains consist of three antiparallel beta-strands, but the C-terminal domain has a long flexible hairpin loop where a heparin-binding consensus sequence is located (1). MK is a member of a highly conserved, developmentally regulated human gene family. The gene product exhibits neurite outgrowth-promoting activity and may play a role in nervous system development and/or maintenance. Expression of MK is predominant only for a short period from approximately one-half to two-thirds of the way through gestation; before and after that, it is barely detectable (2)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-252-PB
Species: Hu
Applications: IHC, WB
288-TPN/CF
Species: Hu
Applications: BA
203-IL
Species: Hu
Applications: BA
AF4117
Species: Rt
Applications: IHC, WB
M6000B
Species: Mu
Applications: ELISA
255-SC
Species: Hu
Applications: BA
NBP1-80670
Species: Hu
Applications: IHC,  IHC-P
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
233-FB
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
MEP00B
Species: Mu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
H00004598-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

Publications for Midkine Recombinant Protein Antigen (NBP2-55458PEP) (0)

There are no publications for Midkine Recombinant Protein Antigen (NBP2-55458PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Midkine Recombinant Protein Antigen (NBP2-55458PEP) (0)

There are no reviews for Midkine Recombinant Protein Antigen (NBP2-55458PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Midkine Recombinant Protein Antigen (NBP2-55458PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Midkine Products

Research Areas for Midkine Recombinant Protein Antigen (NBP2-55458PEP)

Find related products by research area.

Blogs on Midkine

There are no specific blogs for Midkine, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Midkine Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MDK