Midkine Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Midkine Antibody [NBP2-55458] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Midkine Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT
Specificity
Specificity of human Midkine antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDK
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Midkine Antibody

  • Amphiregulin-associated protein
  • ARAP
  • MDK
  • MEK
  • Midgestation and kidney protein
  • midkine (neurite growth-promoting factor 2)
  • Midkine
  • MK1
  • MKARAP
  • NEGF2
  • NEGF2FLJ27379
  • Neurite outgrowth-promoting factor 2
  • Neurite outgrowth-promoting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-252-PB
Species: Hu
Applications: WB, IHC
288-TPN/CF
Species: Hu
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
7270-IL/CF
Species: Hu
NBP1-80670
Species: Hu
Applications: IHC, IHC-P
NBP1-84581
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
NBP1-31559
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Midkine Antibody (NBP2-55458) (0)

There are no publications for Midkine Antibody (NBP2-55458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Midkine Antibody (NBP2-55458) (0)

There are no reviews for Midkine Antibody (NBP2-55458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Midkine Antibody (NBP2-55458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Midkine Products

Bioinformatics Tool for Midkine Antibody (NBP2-55458)

Discover related pathways, diseases and genes to Midkine Antibody (NBP2-55458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Midkine Antibody (NBP2-55458)

Discover more about diseases related to Midkine Antibody (NBP2-55458).
 

Pathways for Midkine Antibody (NBP2-55458)

View related products by pathway.

PTMs for Midkine Antibody (NBP2-55458)

Learn more about PTMs related to Midkine Antibody (NBP2-55458).
 

Research Areas for Midkine Antibody (NBP2-55458)

Find related products by research area.

Blogs on Midkine

There are no specific blogs for Midkine, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Midkine Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MDK