Home » Midkine » Midkine Antibodies » Midkine Antibody

Midkine Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Midkine Antibody [H00004192-D01P] - Analysis of MDK expression in transfected 293T cell line by MDK polyclonal antibody.Lane 1: MDK transfected lysate(15.60 KDa).Lane 2: Non-transfected lysate.
Western Blot: Midkine Antibody [H00004192-D01P] - Analysis of MDK expression in transfected 293T cell line by MDK polyclonal antibody.Lane 1: MDK transfected lysate(15.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related Midkine Primary Antibodies

Order Details


    • Catalog Number
      H00004192-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Midkine Antibody Summary

Immunogen
MDK (NP_001012333.1, 1 a.a. - 143 a.a.) full-length human protein. MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Specificity
MDK - midkine (neurite growth-promoting factor 2),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDK
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Midkine Antibody

  • Amphiregulin-associated protein
  • ARAP
  • MDK
  • MEK
  • Midgestation and kidney protein
  • midkine (neurite growth-promoting factor 2)
  • Midkine
  • MK1
  • MKARAP
  • NEGF2
  • NEGF2FLJ27379
  • Neurite outgrowth-promoting factor 2
  • Neurite outgrowth-promoting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pleiotrophin/PTN
Antibody [Unconjugate ...
AF-252-PB
Pleiotrophin/PTN was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human Pleiotrophin/PTN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-252-PB) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane and extracellular space. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(11 Publications)
Species: Hu
Applications: WB, IHC

Thrombopoietin/THPO [U
288-TPN/CF
Thrombopoietin/THPO [Unconjugated]
(6 Publications)
Species: Hu
IL-3 [Unconjugated]
203-IL/CF
1 μg/lane of Recombinant Human IL-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-3 (Catalog #203‑IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.02‑0.1 ng/mL.
(146 Publications)
Species: Hu
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
(21 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
IL-6 [HRP]
D6050
(25 Reviews)
(466 Publications)
Species: Hu
SCF/c-kit Ligand
[Unconjugated]
7466-SC/CF
SCF/c-kit Ligand [Unconjugated]
(3 Publications)
Species: Hu
Thyroid Peroxidase
Antibody
NBP1-97765
Western Blot: Thyroid Peroxidase Antibody [NBP1-97765] - (0.3ug/ml) staining of Human Thyroid Gland lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Thyroid Peroxidase Antibody [NBP1-97765] - Staining of paraffin embedded Human Thyroid Gland. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Integrin alpha
2b/CD41 Antibody
NBP1-84579
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84579] - Staining of human bone marrow.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84579] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84579] - Staining of human stomach shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. Western blot analysis for protein expressions of intrarenal RAS components in the two groups of mice. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Immunohistochemistry: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. (A) Immunohistochemical analysis of intrarenal RAS expression position in the two groups of mice. AGT immunoreactivity in the proximal tubular cells, Ang II immunoreactivity in both glomerular and tubular cells, renin immunoreactivity in juxtaglomerular apparatus cells, ACE immunoreactivity in brush border membranes of proximal tubules as well as AT1 and AT2 immunoreactivity in the proximal tubules were increased in the HF group when compared to the control group. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
FGF
basic/FGF2/bFGF [Unco
233-FB/CF
Recombinant Human FGF basic/FGF2/bFGF (146 aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The activity is approximately 3-fold greater than the top competitor's FGF basic (146 aa).
1 µg/lane of Recombinant Human FGF basic/FGF2/bFGF (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(369 Publications)
Species: Hu
VEGF [HRP]
DVE00
(26 Reviews)
(514 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(33 Reviews)
(647 Publications)
Species: Hu
Erythropoietin/EPO
[HRP]
MEP00B
(3 Reviews)
(77 Publications)
Species: Mu
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(21 Reviews)
(458 Publications)
Species: Hu
MVK Antibody
[Unconjugated]
AF8516
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, and HEK001 human epidermal keratinocyte cell line. PVDF membrane was probed with 0.1 µg/mL of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for MVK at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MVK was detected in immersion fixed A431 human epithelial carcinoma cell line using Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) at 2 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
MVK was immunoprecipitated from 400 µg of HepG2 human hepatocellular carcinoma cell line and A431 human epithelial carcinoma cell line lysates using 4 µg of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) coated on 4 wells of a 96 well plate (Corning Costar EIA/RIA). HepG2 lysates, A431 lysates, Rabbit IgG control buffer, or recombinant human MVK were added to the wells and incubated for 2 hours at room temperature. Immunoprecipitated MVK was detected by Western blot under reducing conditions using 0.1 µg/mL Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) and Immunoblot Buffer Group 1. View our recommended buffer recipes for Immunoprecipitation.
Species: Hu
Applications: WB, Simple Western, IP, ICC
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Renin Antibody
(OTI2F10)
NBP2-45552
Western Blot: Renin Antibody (2F10) [NBP2-45552] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Renin.
Immunohistochemistry: Renin Antibody (2F10) [NBP2-45552] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: Renin Antibody (2F10) [NBP2-45552] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: WB, IHC

Publications for Midkine Antibody (H00004192-D01P) (0)

There are no publications for Midkine Antibody (H00004192-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Midkine Antibody (H00004192-D01P) (0)

There are no reviews for Midkine Antibody (H00004192-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Midkine Antibody (H00004192-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Midkine Products

Bioinformatics Tool for Midkine Antibody (H00004192-D01P)

Discover related pathways, diseases and genes to Midkine Antibody (H00004192-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Midkine Antibody (H00004192-D01P)

Discover more about diseases related to Midkine Antibody (H00004192-D01P).
 

Pathways for Midkine Antibody (H00004192-D01P)

View related products by pathway.

PTMs for Midkine Antibody (H00004192-D01P)

Learn more about PTMs related to Midkine Antibody (H00004192-D01P).
 

Research Areas for Midkine Antibody (H00004192-D01P)

Find related products by research area.

Blogs on Midkine

There are no specific blogs for Midkine, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Midkine Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MDK
Entrez
Uniprot