Midkine Antibody

Images

 
Western Blot: Midkine Antibody [H00004192-D01P] - Analysis of MDK expression in transfected 293T cell line by MDK polyclonal antibody.Lane 1: MDK transfected lysate(15.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Midkine Antibody Summary

Immunogen
MDK (NP_001012333.1, 1 a.a. - 143 a.a.) full-length human protein. MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Specificity
MDK - midkine (neurite growth-promoting factor 2),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDK
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Midkine Antibody

  • Amphiregulin-associated protein
  • ARAP
  • MDK
  • MEK
  • Midgestation and kidney protein
  • midkine (neurite growth-promoting factor 2)
  • Midkine
  • MK1
  • MKARAP
  • NEGF2
  • NEGF2FLJ27379
  • Neurite outgrowth-promoting factor 2
  • Neurite outgrowth-promoting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
H00004192-D01P
Species: Hu
Applications: WB

Publications for Midkine Antibody (H00004192-D01P) (0)

There are no publications for Midkine Antibody (H00004192-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Midkine Antibody (H00004192-D01P) (0)

There are no reviews for Midkine Antibody (H00004192-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Midkine Antibody (H00004192-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Midkine Products

Bioinformatics Tool for Midkine Antibody (H00004192-D01P)

Discover related pathways, diseases and genes to Midkine Antibody (H00004192-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Midkine Antibody (H00004192-D01P)

Discover more about diseases related to Midkine Antibody (H00004192-D01P).
 

Pathways for Midkine Antibody (H00004192-D01P)

View related products by pathway.

PTMs for Midkine Antibody (H00004192-D01P)

Learn more about PTMs related to Midkine Antibody (H00004192-D01P).
 

Research Areas for Midkine Antibody (H00004192-D01P)

Find related products by research area.

Blogs on Midkine

There are no specific blogs for Midkine, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Midkine Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MDK
Entrez
Uniprot