Midkine Antibody Summary
Immunogen |
MDK (NP_001012333.1, 1 a.a. - 143 a.a.) full-length human protein. MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD |
Specificity |
MDK - midkine (neurite growth-promoting factor 2), |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MDK |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
Quality control test: Antibody reactive against mammalian transfected lysate.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Midkine Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, IHC
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IP, ICC
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu
Applications: WB, IHC
Publications for Midkine Antibody (H00004192-D01P) (0)
There are no publications for Midkine Antibody (H00004192-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Midkine Antibody (H00004192-D01P) (0)
There are no reviews for Midkine Antibody (H00004192-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Midkine Antibody (H00004192-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional Midkine Products
Bioinformatics Tool for Midkine Antibody (H00004192-D01P)
Discover related pathways, diseases and genes to Midkine Antibody (H00004192-D01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Midkine Antibody (H00004192-D01P)
Discover more about diseases related to Midkine Antibody (H00004192-D01P).
| | Pathways for Midkine Antibody (H00004192-D01P)
View related products by pathway.
|
PTMs for Midkine Antibody (H00004192-D01P)
Learn more about PTMs related to Midkine Antibody (H00004192-D01P).
| | Research Areas for Midkine Antibody (H00004192-D01P)
Find related products by research area.
|
Blogs on Midkine