Home » Midkine » Midkine Antibodies » Midkine Antibody

Midkine Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Midkine Antibody [H00004192-D01P] - Analysis of MDK expression in transfected 293T cell line by MDK polyclonal antibody.Lane 1: MDK transfected lysate(15.60 KDa).Lane 2: Non-transfected lysate.
Western Blot: Midkine Antibody [H00004192-D01P] - Analysis of MDK expression in transfected 293T cell line by MDK polyclonal antibody.Lane 1: MDK transfected lysate(15.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Midkine Antibody Summary

Immunogen
MDK (NP_001012333.1, 1 a.a. - 143 a.a.) full-length human protein. MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Specificity
MDK - midkine (neurite growth-promoting factor 2),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDK
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Midkine Antibody

  • Amphiregulin-associated protein
  • ARAP
  • MDK
  • MEK
  • Midgestation and kidney protein
  • midkine (neurite growth-promoting factor 2)
  • Midkine
  • MK1
  • MKARAP
  • NEGF2
  • NEGF2FLJ27379
  • Neurite outgrowth-promoting factor 2
  • Neurite outgrowth-promoting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pleiotrophin/PTN
Antibody [Unconjugate ...
AF-252-PB
Pleiotrophin/PTN Antibody [Unconjugated]
(10 Publications)
Species: Hu
Applications: WB
Thrombopoietin/Tpo
288-TP/CF
1 µg/lane of Recombinant Human Thrombopoietin was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing major bands at 43-60 kDa.
Recombinant Human Thrombopoietin/Tpo (Catalog # 288-TP/CF) stimulates pro­liferation in the MO7e human megakaryocytic leukemic cell line. The ED50 for this effect is 0.3-3 ng/mL.
(50 Publications)
Species: Hu
IL-3 [Unconjugated]
203-IL/CF
1 μg/lane of Recombinant Human IL-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-3 (Catalog #203‑IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.02‑0.1 ng/mL.
(112 Publications)
Species: Hu
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
(17 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
SCF/c-kit Ligand
[Unconjugated]
255-SC/CF
1 μg/lane of Recombinant Human SCF/c-kit Ligand was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 19 kDa.
Recombinant Human SCF/c-kit Ligand (Catalog # 255-SC/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 1-5 ng/mL.
(110 Publications)
Species: Hu
Thyroid Peroxidase
Antibody
NBP1-80670
Immunohistochemistry-Paraffin: Thyroid Peroxidase Antibody [NBP1-80670] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: Thyroid Peroxidase Antibody [NBP1-80670] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Thyroid Peroxidase Antibody [NBP1-80670] - Staining in human thyroid gland and cerebral cortex tissues using anti-TPO antibody. Corresponding TPO RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Integrin alpha
2b/CD41 Antibody (2E1 ...
NBP2-37384
Western Blot: Integrin alpha 2b/CD41 Antibody (2E10C9) [NBP2-37384] - Western blot analysis using ITGA2B mAb against HEK293 (1) and ITGA2B (AA: 45-149)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry: Integrin alpha 2b/CD41 Antibody (2E10C9) [NBP2-37384] - Immunohistochemical analysis of paraffin-embedded rectum cancer tissues using ITGA2B mouse mAb with DAB staining.
Flow Cytometry: Integrin alpha 2b/CD41 Antibody (2E10C9) [NBP2-37384] - Flow cytometric analysis of HL60 cells using ITGA2B mouse mAb (green) and negative control (purple).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
FGF basic/FGF2
[Unconjugated]
233-FB/CF
1 µg/lane of Recombinant Human FGF basic (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human FGF basic (146aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 0.1-0.6 ng/mL.
(231 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(495 Publications)
Species: Hu
EGF [Unconjugated]
236-EG
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
(10 Reviews)
(300 Publications)
Species: Hu
MVK Antibody
[Unconjugated]
AF8516
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, and HEK001 human epidermal keratinocyte cell line. PVDF membrane was probed with 0.1 µg/mL of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for MVK at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MVK was detected in immersion fixed A431 human epithelial carcinoma cell line using Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) at 2 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
MVK was immunoprecipitated from 400 µg of HepG2 human hepatocellular carcinoma cell line and A431 human epithelial carcinoma cell line lysates using 4 µg of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) coated on 4 wells of a 96 well plate (Corning Costar EIA/RIA). HepG2 lysates, A431 lysates, Rabbit IgG control buffer, or recombinant human MVK were added to the wells and incubated for 2 hours at room temperature. Immunoprecipitated MVK was detected by Western blot under reducing conditions using 0.1 µg/mL Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) and Immunoblot Buffer Group 1. View our recommended buffer recipes for Immunoprecipitation.
Species: Hu
Applications: WB, Simple Western, IP, ICC
ACE/CD143 Antibody
[Unconjugated]
AF1513
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
CTLA-4 Antibody
[Unconjugated]
AF-386-PB
Western blot shows lysates of NS0 mouse myeloma cell line either mock transfected or transfected with human CTLA-4. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for CTLA‑4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
NS0 mouse myeloma cell line co-transfected with human CTLA-4 and eGFP was stained with either (A) Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) or (B) Normal Goat IgG Control (Catalog # AB-108-C) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
CTLA‑4 was detected in immersion fixed human peripheral blood mononuclear cells treated with treated with PMA and calcium ionomycin using Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(2 Reviews)
(2 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
HLA DQA1 Antibody
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Species: Hu
Applications: WB, IHC, IHC-P
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC, IP, Neut
Midkine Antibody
H00004192-D01P
Midkine Antibody
Species: Hu
Applications: WB

Publications for Midkine Antibody (H00004192-D01P) (0)

There are no publications for Midkine Antibody (H00004192-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Midkine Antibody (H00004192-D01P) (0)

There are no reviews for Midkine Antibody (H00004192-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Midkine Antibody (H00004192-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Midkine Products

Bioinformatics Tool for Midkine Antibody (H00004192-D01P)

Discover related pathways, diseases and genes to Midkine Antibody (H00004192-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Midkine Antibody (H00004192-D01P)

Discover more about diseases related to Midkine Antibody (H00004192-D01P).
 

Pathways for Midkine Antibody (H00004192-D01P)

View related products by pathway.

PTMs for Midkine Antibody (H00004192-D01P)

Learn more about PTMs related to Midkine Antibody (H00004192-D01P).
 

Research Areas for Midkine Antibody (H00004192-D01P)

Find related products by research area.

Blogs on Midkine

There are no specific blogs for Midkine, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Midkine Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MDK
Entrez
Uniprot