MIA Antibody (3A6)

Images

 
Sandwich ELISA: MIA Antibody (3A6) [H00008190-M02] - Detection limit for recombinant GST tagged MIA is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MIA Antibody (3A6) Summary

Immunogen
MIA (AAH05910, 1 a.a. - 131 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
Specificity
MIA - melanoma inhibitory activity (3A6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MIA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MIA Antibody (3A6)

  • CD-RAP
  • Melanoma inhibitory activity protein
  • melanoma inhibitory activity
  • melanoma-derived growth regulatory protein
  • MIA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for MIA Antibody (H00008190-M02) (0)

There are no publications for MIA Antibody (H00008190-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIA Antibody (H00008190-M02) (0)

There are no reviews for MIA Antibody (H00008190-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MIA Antibody (H00008190-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MIA Products

Bioinformatics Tool for MIA Antibody (H00008190-M02)

Discover related pathways, diseases and genes to MIA Antibody (H00008190-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIA Antibody (H00008190-M02)

Discover more about diseases related to MIA Antibody (H00008190-M02).
 

Pathways for MIA Antibody (H00008190-M02)

View related products by pathway.

PTMs for MIA Antibody (H00008190-M02)

Learn more about PTMs related to MIA Antibody (H00008190-M02).

Blogs on MIA

There are no specific blogs for MIA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIA Antibody (3A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol MIA
Entrez
Uniprot