mGluR5 Antibody (3E7.)

Images

 
ELISA: mGluR5 Antibody (3E7) [H00002915-M07] - Detection limit for recombinant GST tagged GRM5 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E7.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

mGluR5 Antibody (3E7.) Summary

Immunogen
GRM5 (NP_000833 419 a.a. - 518 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CPGYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKG
Specificity
GRM5 - glutamate receptor, metabotropic 5 (3E7)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GRM5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for mGluR5 Antibody (3E7.)

  • glutamate receptor, metabotropic 5
  • GPRC1E
  • GPRC1EMGLUR5metabotropic glutamate receptor 5
  • GRM5
  • mGlu5
  • mGluR5

Background

L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Alternative splice variants of GRM8 have been described but their full-length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP1-44999
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF7387
Species: Hu
Applications: Flow, IHC, CyTOF-ready
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
H00056899-P01
Species: Hu
NBP1-88323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00002915-M07
Species: Hu
Applications: WB, ELISA

Publications for mGluR5 Antibody (H00002915-M07) (0)

There are no publications for mGluR5 Antibody (H00002915-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mGluR5 Antibody (H00002915-M07) (0)

There are no reviews for mGluR5 Antibody (H00002915-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mGluR5 Antibody (H00002915-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mGluR5 Products

Bioinformatics Tool for mGluR5 Antibody (H00002915-M07)

Discover related pathways, diseases and genes to mGluR5 Antibody (H00002915-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mGluR5 Antibody (H00002915-M07)

Discover more about diseases related to mGluR5 Antibody (H00002915-M07).
 

Pathways for mGluR5 Antibody (H00002915-M07)

View related products by pathway.

PTMs for mGluR5 Antibody (H00002915-M07)

Learn more about PTMs related to mGluR5 Antibody (H00002915-M07).
 

Research Areas for mGluR5 Antibody (H00002915-M07)

Find related products by research area.

Blogs on mGluR5

There are no specific blogs for mGluR5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mGluR5 Antibody (3E7.) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRM5
Entrez
Uniprot