MgcRacGAP/RACGAP1 Antibody - BSA Free

Product Discontinued

MgcRacGAP/RACGAP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RACGAP1
• Purity: Affinity purified

Applications/Dilutions

• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MgcRacGAP/RACGAP1 Recombinant Protein Antigen (NBP2-55429PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MgcRacGAP/RACGAP1 Antibody - BSA Free

• GTPase activating protein
• HsCYK-4
• ID-GAP
• KIAA1478
• Male germ cell RacGap
• MgcRacGAP
• MgcRacGAPrac GTPase-activating protein 1
• Rac GTPase activating protein 1
• RACGAP1

Background

Rho GTPases control a variety of cellular processes. There are 3 subtypes of Rho GTPases in the Ras superfamily of small G proteins: RHO (see MIM 165370), RAC (see RAC1; MIM 602048), and CDC42 (MIM 116952). GTPase-activating proteins (GAPs) bind activated forms of Rho GTPases and stimulate GTP hydrolysis. Through this catalytic function, Rho GAPs negatively regulate Rho-mediated signals. GAPs may also serve as effector molecules and play a role in signaling downstream of Rho and other Ras-like GTPases.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RACGAP1