MGC4172 Antibody


Immunohistochemistry-Paraffin: MGC4172 Antibody [NBP2-30686] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: MGC4172 Antibody [NBP2-30686] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: MGC4172 Antibody [NBP2-30686] - Staining in human duodenum and lymph node tissues using anti-DHRS11 antibody. Corresponding DHRS11 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

MGC4172 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGL
Specificity of human MGC4172 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MGC4172 Protein (NBP2-30686PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MGC4172 Antibody

  • ARPG836
  • dehydrogenase/reductase (SDR family) member 11
  • dehydrogenase/reductase SDR family member 11
  • FLJ39232
  • MGC4172
  • SDR24C1
  • short chain dehydrogenase/reductase family 24C, member 1
  • short-chain dehydrogenase/reductase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for MGC4172 Antibody (NBP2-30686) (0)

There are no publications for MGC4172 Antibody (NBP2-30686).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGC4172 Antibody (NBP2-30686) (0)

There are no reviews for MGC4172 Antibody (NBP2-30686). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MGC4172 Antibody (NBP2-30686) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MGC4172 Products

Bioinformatics Tool for MGC4172 Antibody (NBP2-30686)

Discover related pathways, diseases and genes to MGC4172 Antibody (NBP2-30686). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for MGC4172 Antibody (NBP2-30686)

Find related products by research area.

Blogs on MGC4172

There are no specific blogs for MGC4172, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MGC4172 Antibody and receive a gift card or discount.


Gene Symbol DHRS11